DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paip2 and Paip2

DIOPT Version :9

Sequence 1:NP_001262515.1 Gene:Paip2 / 41591 FlyBaseID:FBgn0038100 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001014170.1 Gene:Paip2 / 361309 RGDID:1359176 Length:124 Species:Rattus norvegicus


Alignment Length:125 Identity:49/125 - (39%)
Similarity:69/125 - (55%) Gaps:18/125 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKVPSVDWTDQIIYVVDDDESLSDIDDEPD--FSEYMWMENEEEFDKNELQRLEEEEIMQECFEA 65
            :|.||...|...|  ::||..::....|.|  |:|||||||||||::...:.|.|||.::.||:.
  Rat     1 MKDPSRSSTSPSI--INDDVIINGHSHEEDNPFAEYMWMENEEEFNRQIEEELWEEEFIERCFQE 63

  Fly    66 MIEDELEEQINEW-----EKAKT-----DEQNTALSALPKSQCD-VEKSVLNPMADEFVP 114
            |:|   ||:.:||     :..:|     |:.|..:.:...|..| |.||.|||.|.||||
  Rat    64 MLE---EEEEHEWFIPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNAKEFVP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paip2NP_001262515.1 PAM2 102..117 CDD:399847 10/13 (77%)
Paip2NP_001014170.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 7/22 (32%)
PABPC1-interacting motif-1 (PAM1). /evidence=ECO:0000250 22..75 24/54 (44%)
PABPC1-interacting motif-2 (PAM2). /evidence=ECO:0000250 105..120 6/8 (75%)
PAM2 108..123 CDD:399847 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5309
OMA 1 1.010 - - QHG51398
OrthoDB 1 1.010 - - D1624094at2759
OrthoFinder 1 1.000 - - FOG0004724
OrthoInspector 1 1.000 - - otm45756
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13154
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3889
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.970

Return to query results.
Submit another query.