DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paip2 and Paip2b

DIOPT Version :9

Sequence 1:NP_001262515.1 Gene:Paip2 / 41591 FlyBaseID:FBgn0038100 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_666281.2 Gene:Paip2b / 232164 MGIID:2386865 Length:136 Species:Mus musculus


Alignment Length:113 Identity:36/113 - (31%)
Similarity:58/113 - (51%) Gaps:28/113 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DDESLSDIDD-EPDFSEYMWMENEEEFDKNELQRLEEEEIMQECFEAMIEDE------------- 70
            :|:.|:..:: |..|:|||||||||:|::...:.|:|::.:..||:.|:::|             
Mouse    30 EDQGLNGHEEKENPFAEYMWMENEEDFNRQVEEELQEQDFLDRCFQEMLDEEDQDWFIPARDLPQ 94

  Fly    71 ----LEEQINEWEKAKTDEQNTALSALPKSQCDVEKSVLNPMADEFVP 114
                |::|:|......:.|....||          ||.|||.|.||||
Mouse    95 AVGHLQQQLNGLSVGDSHESEDILS----------KSNLNPDAKEFVP 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paip2NP_001262515.1 PAM2 102..117 CDD:399847 10/13 (77%)
Paip2bNP_666281.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..40 2/9 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..136 13/36 (36%)
PAM2 119..135 CDD:284542 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838330
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DM0X
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5403
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51398
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004724
OrthoInspector 1 1.000 - - otm43677
orthoMCL 1 0.900 - - OOG6_110722
Panther 1 1.100 - - LDO PTHR13154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5420
SonicParanoid 1 1.000 - - X3889
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.