DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7091 and CG3036

DIOPT Version :9

Sequence 1:NP_650243.2 Gene:CG7091 / 41590 FlyBaseID:FBgn0038099 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster


Alignment Length:486 Identity:140/486 - (28%)
Similarity:229/486 - (47%) Gaps:40/486 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SVRLTYAICAFLATCLHAAMRNMLGMIILKMVMPRPEDALVVPAGLSRLTEGNVTSTGRCGSPRV 89
            |.|....:...|...|:.|:|..|.:.|:.||.|.      |.:.::....||.|:.....||..
  Fly    17 SCRQVLNLLTMLGFMLNYALRVNLTIAIVDMVRPN------VTSAVNATLVGNSTAANSTASPDG 75

  Fly    90 VFNPQIQETQSGDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAVAYIL 154
            |   .:.|.:   .||...|.....|.:::||:::....|.||:....:|:|..|:::.::..::
  Fly    76 V---DVYEER---FPWDSYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWASLLTLI 134

  Fly   155 LPAMAHSSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTALLSFAYSGLLMGSMLVYPVA 219
            .|..||.::...:|..|:.|.:.|...||::.:...|..|.||:..:|...:..| |:.:..|:.
  Fly   135 TPLAAHINYVVLIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSNMMASSL-GAAITMPIC 198

  Fly   220 SYL-SNFGWELSFYVVGGVGLSFGIACCFLVYDTVEQHPRISNEEVDYLRQGKSQLGQQRQPVVT 283
            .|| |..||...||:.|.|||.:.:|....||:|...|||||.||...:.:.......:::| ..
  Fly   199 GYLISVAGWASVFYLTGAVGLLWSLAWFTFVYETPATHPRISAEERREIEEAIGTTTSKKRP-SH 262

  Fly   284 IPWKSLLAAPPVYAFILTHMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVM 348
            :||..||.:|.|:|.|:.|....:.|..:|..:|.||.:.:.||:::.|..|:.||||    |.:
  Fly   263 VPWGQLLCSPAVWAIIICHGLAVFGFFTVVNQLPTFMSKILHFDIKQNGLFSSLPYLG----KYV 323

  Fly   349 CILGGSYVE---RRVGPDQNCVRRMLYGICSILTTSLIGVIIL-----ANCDDKILVLVMFAFMM 405
            ..:..||:.   |:.|.......|.|:...:::...|:.::.:     |.....|..|.:||...
  Fly   324 MAVASSYLADYLRKKGTLSTTATRKLFTTFALVIPGLLMIVQVFLGYDATWSVTIFSLALFAHGA 388

  Fly   406 ATTDMGFSGYWPTLLYFAPSFAGLLSGLANGMAHLSGFLAPHLVAALVHTGSKDE----WNVVLM 466
            .|     :||....|..||:|.|.:.||||.::...|||:..:|.||.:   ||:    |.:|..
  Fly   389 VT-----AGYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGALTY---KDQSFHSWQIVFW 445

  Fly   467 TLIVFNTMAMLVFAFCSSTNLQPW-DPRSRM 496
            .|......|.:|||...|..|||| :|..|:
  Fly   446 ILAATYISAAVVFAILGSGELQPWNNPPERV 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7091NP_650243.2 2A0114euk 77..498 CDD:129972 127/434 (29%)
MFS 115..482 CDD:119392 111/379 (29%)
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 139/484 (29%)
MFS 83..461 CDD:119392 114/391 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.