DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7091 and mtre-1

DIOPT Version :10

Sequence 1:NP_650243.2 Gene:CG7091 / 41590 FlyBaseID:FBgn0038099 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_495688.1 Gene:mtre-1 / 174292 WormBaseID:WBGene00011508 Length:158 Species:Caenorhabditis elegans


Alignment Length:52 Identity:12/52 - (23%)
Similarity:16/52 - (30%) Gaps:19/52 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 IACCFLVY-------------------DTVEQHPRISNEEVDYLRQGKSQLG 275
            |..|.|.|                   |..|.|..:..||::..|...:.||
 Worm    10 ILSCVLAYHQYRELKCSTPTNSIRGGPDRAECHLVLKAEELETGRPVPTGLG 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7091NP_650243.2 MFS 31..481 CDD:475125 12/52 (23%)
mtre-1NP_495688.1 None

Return to query results.
Submit another query.