DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7091 and C06E7.88

DIOPT Version :10

Sequence 1:NP_650243.2 Gene:CG7091 / 41590 FlyBaseID:FBgn0038099 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001255275.2 Gene:C06E7.88 / 13194964 WormBaseID:WBGene00189995 Length:167 Species:Caenorhabditis elegans


Alignment Length:32 Identity:9/32 - (28%)
Similarity:14/32 - (43%) Gaps:6/32 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 LSAAPYLGGICSK------VMCILGGSYVERR 359
            |...|...|:.||      :.|..|.|.|:::
 Worm    12 LVGLPVAFGLESKHWQWRLISCKAGDSPVQKK 43

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7091NP_650243.2 MFS 31..481 CDD:475125 9/32 (28%)
C06E7.88NP_001255275.2 None

Return to query results.
Submit another query.