DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and SCARF1

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_003684.2 Gene:SCARF1 / 8578 HGNCID:16820 Length:830 Species:Homo sapiens


Alignment Length:370 Identity:79/370 - (21%)
Similarity:107/370 - (28%) Gaps:129/370 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 ICSK-NICLCRQGYYAR-----------------------NGKCFAELGEIAESTD----ECEY- 423
            :|.| .:|.|:.|::..                       :|:|....|......|    .||: 
Human    68 VCVKPGLCRCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQCQADRWGARCEFP 132

  Fly   424 -------EFDQLTKTCNCQKNYFYERDLRNCRKPIQYHLSCTSNSQCSPFGASYCHP-------- 473
                   ..|..|..|:|:..::..    .||:|.|.:.:.....|.:  ||..|.|        
Human   133 CACGPHGRCDPATGVCHCEPGWWSS----TCRRPCQCNTAAARCEQAT--GACVCKPGWWGRRCS 191

  Fly   474 -----------EIPRRCTCEEYALYDAIKQLCEYKRG---------------LGAECESNDGCPV 512
                       :...||.|.........:|.||..||               .||.||.  .||.
Human   192 FRCNCHGSPCEQDSGRCACRPGWWGPECQQQCECVRGRCSAASGECTCPPGFRGARCEL--PCPA 254

  Fly   513 -DHSVCSNRVCVCADNYFEKDDQCMRGIGADCSVEDDCIPENTECQEKDEEDQSRTCQ--CRKGY 574
             .|.|                 ||....|. |...:.|.|:...|:..:.......||  |..| 
Human   255 GSHGV-----------------QCAHSCGR-CKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPG- 300

  Fly   575 VHFKDECLKEAEELEDECVEDEQCKPLLASCN--SEGKCG--CNDEQHAKNGVCETKRELGESCT 635
             .|.:.|    |:....|...|.|:|....|.  ..|..|  |.|.       |.| ...||.|.
Human   301 -TFGESC----EQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDP-------CPT-GTFGEDCG 352

  Fly   636 KATECYVEKDPENVECRNSVCQCKLGY---SANA------NQNQC 671
            ......|:...:.|   ...|.|..||   |.||      :.|.|
Human   353 STCPTCVQGSCDTV---TGDCVCSAGYWGPSCNASCPAGFHGNNC 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 14/57 (25%)
EB 613..665 CDD:279949 14/54 (26%)
SCARF1NP_003684.2 CSRNP_N <100..135 CDD:292638 6/34 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..539
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 581..688
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.