Sequence 1: | NP_650242.1 | Gene: | CG7381 / 41589 | FlyBaseID: | FBgn0038098 | Length: | 712 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_445834.1 | Gene: | Tnfaip6 / 84397 | RGDID: | 621359 | Length: | 275 | Species: | Rattus norvegicus |
Alignment Length: | 259 | Identity: | 48/259 - (18%) |
---|---|---|---|
Similarity: | 75/259 - (28%) | Gaps: | 97/259 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 CDFASGQCECSTFDTVLAE---NFTQCLATSLIGEKCDDSVQCNLMPTGASC---KAGVCDCADG 104
Fly 105 QNYLRGKCRPLNGLGESCETDLDCYFGYDRASVSCQQNVCGCAN------------GYYNRY--G 155
Fly 156 NIC----RRK------------SMEENDACV----------------VNADC-DELGAGVECVGL 187
Fly 188 VCT--YVDEITTTPGGETEETETTNPGSPEDDDSTTAEAITETADPEQETAFSSRRQLTKAFVH 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7381 | NP_650242.1 | EB | 68..112 | CDD:279949 | 10/46 (22%) |
EB | 101..155 | CDD:279949 | 11/67 (16%) | ||
EB | 570..624 | CDD:279949 | |||
EB | 613..665 | CDD:279949 | |||
Tnfaip6 | NP_445834.1 | Link_domain_TSG_6_like | 36..128 | CDD:239592 | 18/88 (20%) |
CUB | 135..244 | CDD:395345 | 20/108 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |