Sequence 1: | NP_650242.1 | Gene: | CG7381 / 41589 | FlyBaseID: | FBgn0038098 | Length: | 712 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001268729.2 | Gene: | dkk1a / 799377 | ZFINID: | ZDB-GENE-090313-406 | Length: | 247 | Species: | Danio rerio |
Alignment Length: | 221 | Identity: | 46/221 - (20%) |
---|---|---|---|
Similarity: | 70/221 - (31%) | Gaps: | 84/221 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 CETEADCTADGTSCDFASGQCECSTFDTVLAENFTQCLATSLIGEKC-DDSVQCNLMPTGASCKA 96
Fly 97 GVCDCAD-------------------------GQNYLRGK-----CRP----LNGLGESCETDLD 127
Fly 128 CYFGYDRASVSCQQNVCGCANGYYNRY-------GNICRRKSMEENDACVVNADCDELGAGVECV 185
Fly 186 GLVCTYVDEITTTPGGETEETETTNP 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7381 | NP_650242.1 | EB | 68..112 | CDD:279949 | 15/74 (20%) |
EB | 101..155 | CDD:279949 | 17/94 (18%) | ||
EB | 570..624 | CDD:279949 | |||
EB | 613..665 | CDD:279949 | |||
dkk1a | NP_001268729.2 | Dickkopf_N | 68..115 | CDD:282549 | 14/67 (21%) |
COLIPASE | 167..236 | CDD:305210 | 20/89 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |