DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and dkk1a

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001268729.2 Gene:dkk1a / 799377 ZFINID:ZDB-GENE-090313-406 Length:247 Species:Danio rerio


Alignment Length:221 Identity:46/221 - (20%)
Similarity:70/221 - (31%) Gaps:84/221 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CETEADCTADGTSCDFASGQCECSTFDTVLAENFTQCLATSLIGEKC-DDSVQCNLMPTGASCKA 96
            |..:::|:. |..|:.:.|                .||:.....::| .|.:.|    .|..|..
Zfish    68 CSADSECSI-GEFCNGSRG----------------VCLSCRKRRKRCARDGMCC----AGNRCIN 111

  Fly    97 GVCDCAD-------------------------GQNYLRGK-----CRP----LNGLGESCETDLD 127
            |||..||                         |||:...:     .:|    ..|.||:|....|
Zfish   112 GVCQLADAAAVGSADASPPGGNTDVSGVAVTRGQNFTHPRRTTVLSKPQQTQKGGEGETCLRSSD 176

  Fly   128 CYFGYDRASVSCQQNVCGCANGYYNRY-------GNICRRKSMEENDACVVNADCDELGAGVECV 185
            |..|           :| ||..:::|.       |.:|.|...:......:...|| .|:|:.|.
Zfish   177 CLEG-----------LC-CARHFWSRICKPVLTEGQVCTRHRRKGAHGLEIFQRCD-CGSGLTCR 228

  Fly   186 GLVCTYVDEITTTPGGETEETETTNP 211
            |.        ...||.|:....|..|
Zfish   229 GQ--------REKPGAESRNLHTCQP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949 15/74 (20%)
EB 101..155 CDD:279949 17/94 (18%)
EB 570..624 CDD:279949
EB 613..665 CDD:279949
dkk1aNP_001268729.2 Dickkopf_N 68..115 CDD:282549 14/67 (21%)
COLIPASE 167..236 CDD:305210 20/89 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.