DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and tnfaip6

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001035333.2 Gene:tnfaip6 / 678516 ZFINID:ZDB-GENE-060421-2654 Length:271 Species:Danio rerio


Alignment Length:209 Identity:42/209 - (20%)
Similarity:68/209 - (32%) Gaps:80/209 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CDFASGQCECSTFDTVLAE---NFTQCLATSLIGEKCDDSVQCNLMPTGASC---KAGVCDCADG 104
            |:|..|  ..:|||.:.|.   .|..|.|    |......|...::..|::|   |.|:.|    
Zfish    68 CNFEGG--TLATFDQLEAARQIGFHVCAA----GWLDKGRVGYPIVKAGSNCGFGKVGIID---- 122

  Fly   105 QNYLRGKCRPLNGLGESCETDLDCYFGYDRASVSC---------------------QQNVCGCAN 148
            ..|         .|.:|...|:.|   |:..:..|                     .:.:|    
Zfish   123 YGY---------RLNKSERWDVYC---YNPVAKECGGVHTDPEKVLVSPGYPDEYQDEQIC---- 171

  Fly   149 GYYN---RYGNICRRK----SMEENDACV----------------VNADC-DELGAGVECVGLVC 189
             |::   |:|:..|..    .:||:..|:                |...| |:|.......|.|.
Zfish   172 -YWHIRVRFGHRIRLHFLDFDIEEDTDCLSDHLEIYDSYDDVSGFVGRYCGDQLPDDFISTGNVM 235

  Fly   190 T--YVDEITTTPGG 201
            |  ::.:.:.|.||
Zfish   236 TLKFLSDSSVTAGG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949 10/46 (22%)
EB 101..155 CDD:279949 10/77 (13%)
EB 570..624 CDD:279949
EB 613..665 CDD:279949
tnfaip6NP_001035333.2 Link_domain_TSG_6_like 46..138 CDD:239592 22/91 (24%)
CUB 145..254 CDD:278839 19/110 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.