DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and Esm1

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_072126.1 Gene:Esm1 / 64536 RGDID:71013 Length:184 Species:Rattus norvegicus


Alignment Length:182 Identity:39/182 - (21%)
Similarity:58/182 - (31%) Gaps:64/182 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LAVFWPCETEADCT--ADGTSCDFASGQC------ECSTFDTVLAENFTQCLAT--SLIGEKCDD 81
            |.:.|..:...||.  .|.|.|. :|.:|      :|.......|.....|..|  .:.|.||..
  Rat    16 LGMAWSAKYAVDCPEHCDNTECR-SSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGP 79

  Fly    82 SVQCNL----------------MPTG---------ASCKAGVCDCADGQNYLRGKCRPLNGLGES 121
            .::|:.                .|.|         .:|::|:||      .:.|:|         
  Rat    80 GLKCHFYSEEDDFGDEFGVCKDCPYGTFGMDCKETCNCQSGICD------RVTGRC--------- 129

  Fly   122 CETDLDC-YFGYDRAS----VSCQQNVCGCANGYYNRYGNICRRKSMEENDA 168
                ||. :|.|..|.    .|..|.....|:|    .||..|.:..:.|.|
  Rat   130 ----LDFPFFQYAAAKSPSRTSASQTERDAASG----DGNAVREEIGDRNAA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949 13/70 (19%)
EB 101..155 CDD:279949 11/58 (19%)
EB 570..624 CDD:279949
EB 613..665 CDD:279949
Esm1NP_072126.1 IGFBP 28..83 CDD:395164 13/55 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..184 9/33 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.