DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and Dkk2

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_006501881.1 Gene:Dkk2 / 56811 MGIID:1890663 Length:272 Species:Mus musculus


Alignment Length:335 Identity:67/335 - (20%)
Similarity:105/335 - (31%) Gaps:121/335 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 STLGSSRDDDDADEKKYGSSCTDNGKTCSGLPHSICSKNICLCRQGYYARNGKCFAELGEIAEST 418
            |.|||||...::.:...|      |:|.:...:.....|..|...|  ::.||...::|...:.|
Mouse    26 SQLGSSRAKLNSIKSSLG------GETPAQSANRSAGMNQGLAFGG--SKKGKSLGQVGNPPKHT 82

  Fly   419 DECEYEFDQLTKTCNCQKNYFYERDLRNCRKPIQYHLSCTSNSQCSPFGASYCHPEIPRRCTCEE 483
                           .|....|               .|:|:.:|..  ..|||........|  
Mouse    83 ---------------LQPGEAY---------------PCSSDKECEV--GRYCHSPHQGSSAC-- 113

  Fly   484 YALYDAIKQLCEYKRGLGAECESNDG--CPVDHSVCSNRVCVCADNYFEKDDQCMRGIGADCSVE 546
                    .||..|:   ..|. .||  ||  .:.|:|.:|:....                |:.
Mouse   114 --------MLCRRKK---KRCH-RDGMCCP--GTRCNNGICIPVTE----------------SIL 148

  Fly   547 DDCIP--ENTECQEKDEEDQSR-------------TCQCRKGYVHFKDECLKEAEELEDECVE-- 594
            ...||  :.|..::::....|.             .....||  |..|.||:.::.::..|..  
Mouse   149 TPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMPHIKG--HEGDPCLRSSDCIDGFCCARH 211

  Fly   595 --DEQCKPLLASCNSEGKCGCNDEQHAKNGVCETKRELGE---------SCTKATECYVEKDPE- 647
              .:.|||:|    .:|:            ||..:|:.|.         .|.|...|.|.||.. 
Mouse   212 FWTKICKPVL----HQGE------------VCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATY 260

  Fly   648 NVECRNSVCQ 657
            :.:.|..|||
Mouse   261 SSKARLHVCQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 12/57 (21%)
EB 613..665 CDD:279949 14/55 (25%)
Dkk2XP_006501881.1 Dickkopf_N 91..141 CDD:368068 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.