DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and NimC3

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster


Alignment Length:236 Identity:58/236 - (24%)
Similarity:82/236 - (34%) Gaps:62/236 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 NCQKNYFYERDLRNCRKPIQYHLSCTSNSQCSPFGASYCHP-EIPRRCTCEEYALYDAIKQLCE- 495
            :||||...:         .|..::.|..:...|..||  || ::......||...:|.|:..|. 
  Fly    31 HCQKNISVK---------YQVPVAKTRMAGAGPPNAS--HPIDLDSYVVYEERVRWDNIQVCCPG 84

  Fly   496 YKRGLGAECE--SNDGCPVDHSVCS--NRVCVCADNYFEKDDQCMRGIGADCS--VEDDCIPENT 554
            |:..|...||  ..:.||. ||.|:  :| |.|...| |.......|....|.  .:..| ||::
  Fly    85 YRTILFGFCEPVCQEACPA-HSYCAEPDR-CHCQRGY-EPSHHHTTGHQLICRPVCQGGC-PEHS 145

  Fly   555 ECQEKDEEDQSRTCQCRKGYVHFKDECLKEAEELEDECVEDEQCKPLLASCNSEGKCGCNDEQHA 619
            .|...:|      |:|..|   |||.....:..|..|.|:                  |..||..
  Fly   146 HCVAHNE------CECWPG---FKDASSWFSLSLRCERVQ------------------CGHEQRF 183

  Fly   620 KNG--VC--------ETKRELGESCTKATECYVE--KDPEN 648
            ..|  .|        |..:.:.|...|..|...|  .:||:
  Fly   184 DPGRRACVQIEMSMEELMQRVAERLAKGLEAEEEAANEPES 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 12/55 (22%)
EB 613..665 CDD:279949 12/48 (25%)
NimC3NP_524928.2 MSC 85..>212 CDD:286487 38/157 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.