DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and CG17147

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:328 Identity:72/328 - (21%)
Similarity:114/328 - (34%) Gaps:90/328 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 CFAELGEIAESTDECEYEFDQLTKTCNCQKNYFYERDLRNCRKPIQYH------LSCTSNSQCSP 465
            |...|..:|.|....|||     :.|...||....|....|.:.||.:      |:|.||...:|
  Fly    12 CVLLLATVALSASVGEYE-----ELCRLFKNGTKVRKPGTCDQYIQCYDGNGTVLTCPSNQSFNP 71

  Fly   466 FGASYCHPEIPRRCTCEEYALYDAIKQLCEYKRGLGAECESNDG----CPVD---HSVCSNRV-- 521
            ...|                   .:..|....:..|..||..||    .|.:   :..|.|.|  
  Fly    72 SKGS-------------------CVDTLANSNKYCGNRCEGLDGEWVADPTECHKYFYCMNGVPL 117

  Fly   522 ---CVCADNYFEKDDQCMRGIGADC-SVEDDC--IPENTECQEKDEEDQSRTCQCRKGYVHFKDE 580
               |....::.|:...|:.|:.:.| .|.:.|  :.|||:.  ::|:|.:...:|.|...|....
  Fly   118 AGMCPVGQHFDERSQSCLYGVDSMCVDVNNICELVAENTKF--RNEKDCAYYYECDKTGNHASKS 180

  Fly   581 CLKEAEELEDECVEDEQCKPLLASCNSEGKCGCNDEQHAKNGVCETKREL----------GESCT 635
            |...:::.|...||.       .:|....|..|.  .|:|..||.:...:          |....
  Fly   181 CTVTSKKREYFDVES-------GNCVEANKVECT--AHSKENVCTSSTTMTFKSDQATCRGYFVC 236

  Fly   636 KA-----------TEC----YVEKD------PENVECRNSVCQCKLGYSANANQNQC---IRVMP 676
            ||           |:|    :.::|      |..|.|.::.|..:......::.|.|   ||.:.
  Fly   237 KALYPVADLDPLWTQCPEGYFFDEDRQLCANPTTVVCTHNRCDGRGTMLVTSSSNNCHNYIRCVD 301

  Fly   677 NKK 679
            ||:
  Fly   302 NKE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 12/53 (23%)
EB 613..665 CDD:279949 15/82 (18%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 9/51 (18%)
ChtBD2 89..136 CDD:214696 11/46 (24%)
CBM_14 278..332 CDD:279884 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.