DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and CG17145

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001262098.1 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster


Alignment Length:335 Identity:71/335 - (21%)
Similarity:112/335 - (33%) Gaps:125/335 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 PHSICSKNI-CLCRQGYYARNGKCFAELGEIAESTDECEYEFDQLTKTCNCQKNYFYERDLRNCR 448
            |.| ||::| |:....||:                            ||. ....|:::|...|.
  Fly    42 PES-CSQSITCIDSVSYYS----------------------------TCT-GSTPFFDKDTGKCV 76

  Fly   449 KPIQYHLSCTSNSQCS-------------P---FGASYC-HPEIPRRCTCEEYALYDAIKQLC-- 494
            |.:.     ||.|.||             |   :|..|| ..|.....||.:...::|..|:|  
  Fly    77 KSLS-----TSTSSCSISCADRAKQFVADPKSCYGYYYCADEETALYGTCPQETHFNATTQMCSR 136

  Fly   495 -----------EY----KRGLGAECESNDGCPVDHSVCSNRVC---VCADNYFE-KDDQCMRGIG 540
                       ||    |.|:  ..::..||.:.| ||...|.   .|:..|:: ...:|:....
  Fly   137 QHESDCTTSTFEYCSIVKNGV--NFDNLQGCNMYH-VCEKGVLKDKTCSKTYYQASTGECVSKAL 198

  Fly   541 ADCSVE----DDCIPENTECQEKDEEDQSRTCQCRKGYVHFKDECLKEAEELED------ECVED 595
            .||...    |.|...:...:.|...|:: ||   :||.:    |.|:.:...|      :|.:|
  Fly   199 VDCDAHPLPTDVCGKASKPYENKFVADEA-TC---RGYFY----CAKQKDGTPDPNPVWNQCPQD 255

  Fly   596 -------EQC-KPLLASCNSEGKC-------------GCNDEQHAKNGVCETKRELGE------- 632
                   :.| .|....| |..:|             ||.:.....:||..::|..|.       
  Fly   256 RFFDASSQMCITPSSVYC-SHDRCDGRTASFVVSATKGCRNYLSCSDGVTVSERSCGNYFFDDQQ 319

  Fly   633 -SCTKATECY 641
             :||.:.:.|
  Fly   320 GACTPSVQTY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 15/80 (19%)
EB 613..665 CDD:279949 8/37 (22%)
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 10/50 (20%)
CBM_14 278..327 CDD:279884 9/48 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.