DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and NimC4

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster


Alignment Length:283 Identity:71/283 - (25%)
Similarity:96/283 - (33%) Gaps:73/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 KCFAELGEIAESTD-ECEYEFDQLTKTCNCQKNYFYERDLRN--CRKPIQYHLSCTSNSQCSPF- 466
            |.:.:..:|.|..| |.|....:|.:.| |......|..|..  |.:....|.||.:..:|... 
  Fly    50 KIWKKTEKITEIYDSEEEQVTHRLVREC-CPGYLQVESGLCEPICSRGCPAHASCAAPDRCECIS 113

  Fly   467 ----------GASYCHPEIPRRCTCEEYALYDAIKQLCEYKRGLGAECESNDGCPVDHSVCSNRV 521
                      |:.||.|                   :||.....||:|           |..| .
  Fly   114 GYVSARNHQDGSHYCEP-------------------ICETPCPAGAQC-----------VTPN-T 147

  Fly   522 CVCADNYFE---KDDQCMRGIGADCSVEDDCIPENTECQEKDEEDQSRTCQCRKGYVHFKDE--C 581
            |.|.|.|.:   .||....|....|.|.|.|  .|.:|.:.|.      |.|..||...|.|  |
  Fly   148 CACRDGYTQLQPTDDGVSGGCAPVCRVGDGC--ANGKCIDVDR------CACNSGYRWDKAEERC 204

  Fly   582 LK-EAEELED--ECVEDEQCKPLLASCNSEGKCGCNDEQHAKNGVCETKR----ELGESCTKATE 639
            :: .||.:.:  |..||....|..:|........|.|:.....|.|..|:    ::|  |.| :.
  Fly   205 IELSAESISEELETTEDNTDSPSTSSTAVFTATHCPDDFVLFRGECREKQFDSNDVG--CLK-SG 266

  Fly   640 CYVEKDPENVECRNSVCQCKLGY 662
            |    .|......:.||||..||
  Fly   267 C----GPHQTCLDSGVCQCSDGY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 16/58 (28%)
EB 613..665 CDD:279949 16/54 (30%)
NimC4NP_609698.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.