DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and NimC2

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster


Alignment Length:451 Identity:98/451 - (21%)
Similarity:139/451 - (30%) Gaps:190/451 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 IKTYSTLGSSRDDDDADEKKYGSSCTDN-----GKT------------CSG---------LPHSI 388
            :|...||.:.|...::      ::||.|     |:|            |.|         :|  :
  Fly    24 VKMRGTLVTMRKHQNS------ANCTTNCGPLVGRTRTETYLGFTDVCCDGYIRDENNECVP--L 80

  Fly   389 CS----------KNICLCRQGYYAR---------------NGKCFAELGEIAESTDECE----YE 424
            |:          .|:|||.:||.:|               ||||.|        .||||    :.
  Fly    81 CNDCGASGKCLLPNVCLCGKGYVSRKDHGHCEPECSESCVNGKCVA--------PDECECLAGHR 137

  Fly   425 FDQLTKT--------------------CNCQKNYFYERDLRNCRKPIQ---YHLSCTSNSQCSPF 466
            |...::|                    |.|...|..:..|:.|....|   ||..|.:.::|.  
  Fly   138 FVNGSQTACEPICVEDCANGRCLETGKCLCNNGYQRDEKLKKCVPICQDACYHGDCVAPNECR-- 200

  Fly   467 GASYCHPEIPRRCTCEEYALYDAIKQLCEYKRGLGAECESNDGCPVDHSVCSN------RVCVCA 525
                |||...:|.         .:..:|:               |:..|.|:|      .||.|.
  Fly   201 ----CHPGHEQRL---------GVPWICD---------------PICSSGCANGYCQGAEVCACK 237

  Fly   526 DNYFEKDDQCMRGIGADCSVEDDCIP--ENTECQEKDEEDQSRTCQCRKGYVHFKDECLKEAEEL 588
            ..|..||:....|    |  |..|.|  .|..|.....      |.|.:|:|.        ||..
  Fly   238 MGYAHKDNTLASG----C--EPVCNPPCTNGTCISPGH------CACSEGHVF--------AEGS 282

  Fly   589 EDECVEDEQCKPLLAS--CNSEGKCGCND-----EQHAKNGVCETKRELGESCTKATEC-----Y 641
            ..|||  ..|:....:  |:|.|:|.|::     ..|..:..|.........|.....|     |
  Fly   283 RHECV--PSCRSGCENGYCSSPGRCECHEGFEKTSPHRCSPTCRPGCGQNSRCAAPDTCACDVGY 345

  Fly   642 VEKDPENVE--------CRN------SVCQCKLGYSANAN-------QNQCIR---VMPNK 678
            |..:....|        |||      .||.|..|:.|..:       ...||.   |.||:
  Fly   346 VFVNGSTTECEPFCPRNCRNGICSSPGVCTCLEGFQALLSFYCIPVCSKTCIHGSCVAPNE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 15/60 (25%)
EB 613..665 CDD:279949 15/75 (20%)
NimC2NP_001285922.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.