DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and NimB4

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster


Alignment Length:473 Identity:97/473 - (20%)
Similarity:159/473 - (33%) Gaps:180/473 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 STSTSSRR--------NSSRNQRHAHGQRRRLPALFRFDDEDIKTYSTLGSSRDDDDADE----- 367
            |:||::|:        :..|...|....|:.:||:|...|:::|   .:|:|..:...:.     
  Fly    65 SSSTTTRKPYIIPNGLSLPRRGEHPDKCRQEVPAVFFQYDKEVK---IVGNSSTNPYMNVIEVCC 126

  Fly   368 ---KKY-----------GSSCTDNGKTCSGLPHSICSKNICLCRQGY---YARNGKCFAELGEIA 415
               ::|           |..|.:||...:|        ..|:|...:   |..|......||   
  Fly   127 KGWRRYEYDWSQCVPDCGERCQENGFCVAG--------GKCVCFTDFVLNYRNNCVPTCPLG--- 180

  Fly   416 ESTDECEYEFDQLTKTCNCQKNYFYERDLRNCRKPIQYHLSCTSNSQCSPFGASYCHPEIPRRCT 480
                 |.:....|..||.|.|.|..:...:.|:.  |.:.:|..|..|..          |.:|:
  Fly   181 -----CPHGRCYLNGTCQCDKGYELDGSRKFCQP--QCNATCGHNEVCLE----------PGKCS 228

  Fly   481 CEE---YALYDAIKQLCE------------------------YKRGLGAECESNDGCPVDHSVCS 518
            |.|   ..|.::....|:                        .||..|..||.:.....::..|:
  Fly   229 CAEGYTRGLRESAALGCQPICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDCYMTCENGFCA 293

  Fly   519 NR-VCVCADNY-FEKD-DQCMRGIGADCSVEDDCI-PENTECQEKDEEDQSRTCQCRKGYVHFKD 579
            |: .|||.:.| ::|: ..|:...|.:|. ...|| |.|              |:|.||||..::
  Fly   294 NKTTCVCQNGYRYDKNTTTCLPDCGDNCD-NGVCISPGN--------------CRCFKGYVRNRE 343

  Fly   580 ECLKEAEELEDECVEDEQCKPLLASCNSEGK------CGC-------NDEQHAKNGVCETKRELG 631
            .|       |..||         ..|...||      |||       ...|..:.|:|..   :|
  Fly   344 RC-------EAVCV---------GGCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCNA---MG 389

  Fly   632 ESCTKATECYVEKDPENVECRNSVCQCKLGYSANANQNQCI---------RVMPNKKNSSGRPSA 687
            .                       |:|::|.:...  ::|:         .:.|.|.|:|     
  Fly   390 R-----------------------CRCQVGMTRFI--DRCMSPDTVTTYASMNPVKVNAS----- 424

  Fly   688 LKIITF-MLIGSAFLITS 704
             .|..| :|:|..|.:|:
  Fly   425 -LIQEFNLLLGRHFNLTT 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 17/66 (26%)
EB 613..665 CDD:279949 8/58 (14%)
NimB4NP_788046.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.