Sequence 1: | NP_650242.1 | Gene: | CG7381 / 41589 | FlyBaseID: | FBgn0038098 | Length: | 712 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_552821.3 | Gene: | AgaP_AGAP008933 / 3291851 | VectorBaseID: | AGAP008933 | Length: | 272 | Species: | Anopheles gambiae |
Alignment Length: | 198 | Identity: | 42/198 - (21%) |
---|---|---|---|
Similarity: | 60/198 - (30%) | Gaps: | 72/198 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 VDEITTTPGGE------TEETETTNPGSPEDDDSTTAEAITETADPEQETAFSSRRQLTKAFVHA 250
Fly 251 P------PP------------------THSDAAAQV----------------SFAQLTNGDTEPL 275
Fly 276 ISPRSHEIAVQTSIEKYELREVGRSVRNAATATTT--TTATASTSTSSRRNSSRNQRHAHGQRRR 338
Fly 339 LPA 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7381 | NP_650242.1 | EB | 68..112 | CDD:279949 | |
EB | 101..155 | CDD:279949 | |||
EB | 570..624 | CDD:279949 | |||
EB | 613..665 | CDD:279949 | |||
AgaP_AGAP008933 | XP_552821.3 | KAR9 | <3..183 | CDD:285747 | 32/168 (19%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D561378at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |