DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and AgaP_AGAP008933

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_552821.3 Gene:AgaP_AGAP008933 / 3291851 VectorBaseID:AGAP008933 Length:272 Species:Anopheles gambiae


Alignment Length:198 Identity:42/198 - (21%)
Similarity:60/198 - (30%) Gaps:72/198 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 VDEITTTPGGE------TEETETTNPGSPEDDDSTTAEAITETADPEQETAFSSRRQLTKAFVHA 250
            |.|:...|.|:      .:..:.....:|....|||.......:.|....|..:.|.|..|:...
Mosquito    28 VREMPIPPAGQPTRLPPDDSVQRAAVSTPARTGSTTIRRRVPASSPRWTPAAIASRTLPTAYSER 92

  Fly   251 P------PP------------------THSDAAAQV----------------SFAQLTNGDTEPL 275
            |      ||                  .|:.|||:.                .|....|....| 
Mosquito    93 PATIRTLPPWMTTTLTPARANRTGTTRMHAPAAARTISARTGTRSRTCASRDKFTPRVNASPAP- 156

  Fly   276 ISPRSHEIAVQTSIEKYELREVGRSVRNAATATTT--TTATASTSTSSRRNSSRNQRHAHGQRRR 338
                |....|.:.|         |.|.:..|.||.  |.:.|||:::|   .:|:.||       
Mosquito   157 ----SCRACVTSRI---------RPVPDGPTGTTRIGTPSVASTTSAS---GARSCRH------- 198

  Fly   339 LPA 341
            |||
Mosquito   199 LPA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949
EB 613..665 CDD:279949
AgaP_AGAP008933XP_552821.3 KAR9 <3..183 CDD:285747 32/168 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.