DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and CG11674

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster


Alignment Length:228 Identity:53/228 - (23%)
Similarity:92/228 - (40%) Gaps:46/228 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 LSCTSNSQCSPFGASYCHPEIPRRCTCE-----EYALYDAIKQLCEYKRGLGAECESNDGCPVDH 514
            |||:|::||:.|....|   :...|.|.     |......:::..:....:|..|.    ||:.:
  Fly    27 LSCSSDAQCAQFERGRC---VDMACICTARGSGERVPCTPLEERLKLTNIIGGACP----CPMPN 84

  Fly   515 SVCSNR--VCVCADNYFEKDD--QCMRG---IGADCSVEDDCIPENTECQEKDEEDQ--SRTCQC 570
            ::|..|  .|.|::.:...||  :|:..   :|..|..:.       :||..|....  ...|.|
  Fly    85 AICHTRWQQCHCSEGHVSSDDRRRCLPAVVPVGGSCEFQQ-------QCQRADRFSSCIGNQCLC 142

  Fly   571 RKGYVHFKDECLKEAEELEDECVEDEQCKPLLAS-CNSEGK-CGCNDEQHAKNGV-------CET 626
            ...:...:..||   ..|:..|:||:.|....|| |.::.| |||     :||.|       |..
  Fly   143 LNQFEFHEGRCL---SVLQSSCLEDKDCGSCGASICLTKTKRCGC-----SKNFVHNHNMTKCIK 199

  Fly   627 KRELGESCTKATECYVEKDPENVECRNSVCQCK 659
            ....|::|..::.|.:....:. .|.:.:|.|:
  Fly   200 GSAYGDTCEHSSPCKLNLGADG-RCLDHLCVCR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 18/62 (29%)
EB 613..665 CDD:279949 11/54 (20%)
CG11674NP_572948.1 EB 96..153 CDD:279949 11/63 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39069
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.