DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and Ccbe1

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_848908.1 Gene:Ccbe1 / 320924 MGIID:2445053 Length:408 Species:Mus musculus


Alignment Length:281 Identity:62/281 - (22%)
Similarity:100/281 - (35%) Gaps:95/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 DDDDADEKKYGSSCTDNGKTCSGLPHSICSKN-----ICL---CRQGYYARNGKCFAELGEI--- 414
            :.:|.|.:    .|::|..|.:..|   |.|:     .|.   |.:||....|:|..|..:|   
Mouse    39 EPEDRDRE----VCSENKITTTKYP---CLKSSGELTTCFRKKCCKGYKFVLGQCIPEDYDICAQ 96

  Fly   415 AESTDECEYEFDQLTKTCNCQKNYFYERDLRNCRKPIQYHLSCTSNSQCSPFGASYC-HPEIPRR 478
            |....:|...|.::  .|.|...|.|:|: |:.::...|   |....:|:....:.| |      
Mouse    97 APCEQQCTDNFGRV--LCTCYPGYRYDRE-RHQKRERPY---CLDIDECATSNTTLCAH------ 149

  Fly   479 CTCEEYALYDAIKQLCEYKRGLGAECESNDGCPVDHSVCSNRV----CVCADNYFEKDD--QCMR 537
                                                 :|.|.:    |.|.:.|..:||  .|.|
Mouse   150 -------------------------------------ICINTMGSYHCECREGYILEDDGRTCTR 177

  Fly   538 GIGADCSVEDDCIPENTECQEKDE-EDQSRTCQCRKGYVHFKDECLKEAEELEDECVEDEQCKPL 601
            |         |..|.:|..:||.| |.::.|| |.        .| ||..:::...::.:|...|
Mouse   178 G---------DKYPNDTGHEEKSENEVKAGTC-CA--------TC-KEFSQMKQTVLQLKQKMAL 223

  Fly   602 LASCNSE-GKCGCNDEQHAKN 621
            |.:..:| ||....|:..|.|
Mouse   224 LPNNAAELGKYVNGDKVLASN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 13/53 (25%)
EB 613..665 CDD:279949 3/9 (33%)
Ccbe1NP_848908.1 EGF_CA 135..176 CDD:214542 10/83 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.