DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and NimA

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:305 Identity:65/305 - (21%)
Similarity:98/305 - (32%) Gaps:96/305 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CSTFDTVLAENF-TQCLATSLIGEKCDDSVQCNLMPTGASCK--------------AGVCDCADG 104
            |:||.|.:.|.. .|.|..:.....|....:.||..:.|:||              ..:|.|.:|
  Fly    87 CATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEG 151

  Fly   105 QNYLRGKCRPLNGLGESCETDLDCYFGYDRASVSCQQNVCGCANGY------------------- 150
            .            :|:.|....|    :||..:.| :|:|.|.||.                   
  Fly   152 Y------------IGKHCTQRCD----HDRWGLDC-KNLCQCQNGAACDNKSGLCHCIAGWTGQF 199

  Fly   151 ------YNRYGNICRRKSMEENDACVVNADCDE------LGAGVECVGLVCTYVDEITTTPGGET 203
                  ...||.:||:       ||    ||||      .||.::....:...|..:.......|
  Fly   200 CELPCPQGTYGIMCRK-------AC----DCDEKPCNPQTGACIQQDQPLQLNVSHVIVETVNST 253

  Fly   204 EETETTNPGSPEDDDSTTAEAITETADPEQETAFSSRRQLTKAFVHAPPP-----THSDAAAQVS 263
            .|.....|      ..||...:.|....:|.|:..:.:...|..||....     .|:.|||.|.
  Fly   254 LEKMGIIP------RPTTPVPLPEVIVIKQPTSNENAQHSPKIIVHQSSSDLLENLHTAAAAGVP 312

  Fly   264 FAQLTNGDTEPLISPRSHEIAVQTSIEKYELREVGRSVRNAATAT 308
            ..::.:..|..:.||:.|....           ||....::.|||
  Fly   313 TPEVIHVITNGITSPQEHLAGF-----------VGGEANSSQTAT 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949 11/57 (19%)
EB 101..155 CDD:279949 13/78 (17%)
EB 570..624 CDD:279949
EB 613..665 CDD:279949
NimANP_001285918.1 EMI 52..116 CDD:284877 8/28 (29%)
EGF_2 170..200 CDD:285248 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.