DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and DKK3

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001317149.1 Gene:DKK3 / 27122 HGNCID:2893 Length:364 Species:Homo sapiens


Alignment Length:146 Identity:38/146 - (26%)
Similarity:50/146 - (34%) Gaps:51/146 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CETEADCTADGTS--CDFASGQ--CECSTFDTVLAENFTQCLATSLIGEKCDDSV----QCNLMP 89
            |..:.||   |.|  |.|||.|  |:......:|....::|         |.|.:    .|..|.
Human   147 CIIDEDC---GPSMYCQFASFQYTCQPCRGQRMLCTRDSEC---------CGDQLCVWGHCTKMA 199

  Fly    90 TGAS----------CKAGVCDCADGQNYLRGKCRPLNGLGESCET-----------DLDCYFGYD 133
            |..|          |:.|:| ||..:..|...|.||...||.|..           :|:.....|
Human   200 TRGSNGTICDNQRDCQPGLC-CAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALD 263

  Fly   134 RASVSCQQNVCGCANG 149
            |         |.||:|
Human   264 R---------CPCASG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949 13/57 (23%)
EB 101..155 CDD:279949 16/60 (27%)
EB 570..624 CDD:279949
EB 613..665 CDD:279949
DKK3NP_001317149.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.