Sequence 1: | NP_650242.1 | Gene: | CG7381 / 41589 | FlyBaseID: | FBgn0038098 | Length: | 712 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055235.1 | Gene: | DKK4 / 27121 | HGNCID: | 2894 | Length: | 224 | Species: | Homo sapiens |
Alignment Length: | 234 | Identity: | 50/234 - (21%) |
---|---|---|---|
Similarity: | 76/234 - (32%) | Gaps: | 86/234 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 443 DLRNCRKPIQYHLSCTSNSQCSPFGASYC---HPEIPRRCTCEEYALYDAIKQLCEYKRGLGAEC 504
Fly 505 ESNDGCPVDHSVCSNRVCVCADN---YFEKDDQCMRGIGADCSVEDDCIPENTECQE-------- 558
Fly 559 -KDEEDQS--RTCQCRKGYV---HFKDECLKEAEELEDECVEDEQCKPLLAS---CNSEG----- 609
Fly 610 -------KCGC-----------NDEQHAKNGVCETKREL 630 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7381 | NP_650242.1 | EB | 68..112 | CDD:279949 | |
EB | 101..155 | CDD:279949 | |||
EB | 570..624 | CDD:279949 | 15/82 (18%) | ||
EB | 613..665 | CDD:279949 | 7/29 (24%) | ||
DKK4 | NP_055235.1 | Dickkopf_N | 41..91 | CDD:309719 | 16/68 (24%) |
DKK-type Cys-1 | 41..90 | 15/67 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 109..139 | 4/30 (13%) | |||
DKK-type Cys-2 | 145..218 | 17/88 (19%) | |||
Prokineticin | <145..202 | CDD:148298 | 14/72 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |