DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and NimB2

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:338 Identity:79/338 - (23%)
Similarity:111/338 - (32%) Gaps:106/338 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 EDIKTYSTLGSSRDDDDADEKKYGSSCTDNGKTCSGLPHSICSKNICLCRQGYYARNGKCFAELG 412
            :::.|.|.|.:|||           ....||.|..       ...|.:|..| |.||...:....
  Fly   137 KEVPTASLLRNSRD-----------QFVGNGTTPD-------MSRIQVCCDG-YERNPHIYRRCE 182

  Fly   413 EIAESTDECEYEFDQLTKTCNCQKNYFYERDLRNCRKPIQYHLSCTSNSQC---SPFGASYCHPE 474
            .|.  .|:|.........||.|                |..|:. |:..:|   .|.|......:
  Fly   183 PIC--ADDCRNGICTAPNTCVC----------------IPGHVR-TAEGKCISTCPLGCGNGVCD 228

  Fly   475 IPRRCTCEE-YALYDAIKQLCEYKRGLGAECESNDGCPVDHSVCSNRVCVCADNYFEKDDQCMRG 538
            ....|.|.| |:|....::.|:      .||:  .||.....|..|: |.|.|.|         .
  Fly   229 ERNECKCREGYSLEPETRKYCQ------PECK--PGCSFGRCVAPNK-CACLDGY---------R 275

  Fly   539 IGADCSVE---DDCIPENTECQEKDEEDQSRTCQCRKGYVHFKDECLKEAEELEDECVEDEQCKP 600
            :.||.|.|   |.|  ||.:|.....      |.|..||:..:.                 :|:|
  Fly   276 LAADGSCEPVCDSC--ENGKCTAPGH------CNCNAGYLKLQG-----------------RCEP 315

  Fly   601 LLASCNSEGKCGCNDEQHAKNGVCETKRELGESCTKATECYVEKDPENVECRNSV------CQCK 659
            :.:.....|:|...|       :||..... |...|:.||..:.|   :.|.|.|      |.||
  Fly   316 ICSIPCKNGRCIGPD-------ICECASGF-EWDRKSAECLPKCD---LPCLNGVCVGNNQCDCK 369

  Fly   660 LGYSANANQ-NQC 671
            .||..:.:| |.|
  Fly   370 TGYVRDEHQRNIC 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 8/53 (15%)
EB 613..665 CDD:279949 16/57 (28%)
NimB2NP_723857.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.