Sequence 1: | NP_650242.1 | Gene: | CG7381 / 41589 | FlyBaseID: | FBgn0038098 | Length: | 712 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_663567.1 | Gene: | Dkk4 / 234130 | MGIID: | 2385299 | Length: | 221 | Species: | Mus musculus |
Alignment Length: | 210 | Identity: | 43/210 - (20%) |
---|---|---|---|
Similarity: | 73/210 - (34%) | Gaps: | 72/210 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 457 CTSNSQCSPFGASYC---HPEIPRRCTCEEYALYDAIKQLCEYKRGLGAECESNDGCPVDHSVCS 518
Fly 519 NRVCVCADNYFEKDDQCMRGIGADCSVEDDCIPENT--------ECQEKDEEDQSRTCQCRKGYV 575
Fly 576 HFKDECLKEAEELEDECVE----DEQCKPLLAS---CNSEG------------KCGC-------- 613
Fly 614 ---NDEQHAKNGVCE 625 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7381 | NP_650242.1 | EB | 68..112 | CDD:279949 | |
EB | 101..155 | CDD:279949 | |||
EB | 570..624 | CDD:279949 | 14/83 (17%) | ||
EB | 613..665 | CDD:279949 | 5/24 (21%) | ||
Dkk4 | NP_663567.1 | Dickkopf_N | 41..91 | CDD:368068 | 18/68 (26%) |
DKK-type Cys-1 | 41..90 | 17/67 (25%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 101..143 | 9/53 (17%) | |||
DKK-type Cys-2 | 145..218 | 13/72 (18%) | |||
Prokineticin | <145..202 | CDD:148298 | 11/56 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |