DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and Dkk4

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_663567.1 Gene:Dkk4 / 234130 MGIID:2385299 Length:221 Species:Mus musculus


Alignment Length:210 Identity:43/210 - (20%)
Similarity:73/210 - (34%) Gaps:72/210 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 CTSNSQCSPFGASYC---HPEIPRRCTCEEYALYDAIKQLCEYKRGLGAECESNDGCPVDHSVCS 518
            |.|:..||.  ..:|   |.|.....||..      :::.|:    ..|.|     ||  .:||.
Mouse    41 CASDRDCSE--GKFCLAFHDERSFCATCRR------VRRRCQ----RSAVC-----CP--GTVCV 86

  Fly   519 NRVCVCADNYFEKDDQCMRGIGADCSVEDDCIPENT--------ECQEKDEEDQSRTCQCRKGYV 575
            |.||...::.....|:...|       :|....|.|        ..|.|....:|::.:.::|  
Mouse    87 NDVCTAVEDTRPVMDRNTDG-------QDGAYAEGTTKWPAEENRPQGKPSTKKSQSSKGQEG-- 142

  Fly   576 HFKDECLKEAEELEDECVE----DEQCKPLLAS---CNSEG------------KCGC-------- 613
               :.||:.::.....|..    .:.|||:|..   |:..|            :|.|        
Mouse   143 ---ESCLRTSDCGPGLCCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDCGPGLTCRS 204

  Fly   614 ---NDEQHAKNGVCE 625
               ::.||::..||:
Mouse   205 QVTSNRQHSRLRVCQ 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 14/83 (17%)
EB 613..665 CDD:279949 5/24 (21%)
Dkk4NP_663567.1 Dickkopf_N 41..91 CDD:368068 18/68 (26%)
DKK-type Cys-1 41..90 17/67 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..143 9/53 (17%)
DKK-type Cys-2 145..218 13/72 (18%)
Prokineticin <145..202 CDD:148298 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.