DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and Tnfaip6

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_033424.1 Gene:Tnfaip6 / 21930 MGIID:1195266 Length:275 Species:Mus musculus


Alignment Length:230 Identity:46/230 - (20%)
Similarity:72/230 - (31%) Gaps:80/230 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CDFASGQCECSTFDTVLAE---NFTQCLATSLIGEKCDDSVQCNLMPTGASC---KAGVCDCADG 104
            |:|..|:  .:|:..:.|.   .|..|.|    |......|...::..|.:|   |.|:.|..  
Mouse    58 CEFEGGR--LATYKQLEAARKIGFHVCAA----GWMAKGRVGYPIVKPGPNCGFGKTGIIDYG-- 114

  Fly   105 QNYLRGKCRPLNGLGESCETDLDCYFGYDRASVSCQQNVCG----------CANGYYNRY--GNI 157
               :|        |..|...|..||..:.:.        ||          .:.|:.|.|  ..:
Mouse   115 ---IR--------LNRSERWDAYCYNPHAKE--------CGGVFTDPKRIFKSPGFPNEYDDNQV 160

  Fly   158 C----RRK------------SMEENDACV----------------VNADC-DELGAGVECVGLVC 189
            |    |.|            .:|.:..|:                |...| |||...:...|.|.
Mouse   161 CYWHIRLKYGQRIHLSFLDFDLEHDPGCLADYVEIYDSYDDVHGFVGRYCGDELPEDIISTGNVM 225

  Fly   190 T--YVDEITTTPGGETEETETTNPGSPEDDDSTTA 222
            |  ::.:.:.|.||...:..|.:|.|.......|:
Mouse   226 TLKFLSDASVTAGGFQIKYVTVDPASKSSQAKNTS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949 10/46 (22%)
EB 101..155 CDD:279949 11/65 (17%)
EB 570..624 CDD:279949
EB 613..665 CDD:279949
Tnfaip6NP_033424.1 Link_domain_TSG_6_like 36..128 CDD:239592 19/88 (22%)
CUB 135..244 CDD:278839 21/108 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..275 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.