DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and M03F4.6

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_508843.1 Gene:M03F4.6 / 180768 WormBaseID:WBGene00019759 Length:413 Species:Caenorhabditis elegans


Alignment Length:404 Identity:89/404 - (22%)
Similarity:125/404 - (30%) Gaps:152/404 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 EKKYGSSCTDNGKTCSGLPHSICSKNICLCRQGYYARNGKCFAELGEIAESTDECEYEFDQLTKT 431
            :|..||.|..: :.|.|: :|:|..:.|.|                    .|:..||:.|:.|..
 Worm    28 QKLIGSDCLFD-EECYGM-NSVCRNSRCTC--------------------PTNFEEYDIDERTTI 70

  Fly   432 C---------NCQKNYFYERDLRNCRKPI------------------------------------ 451
            |         :||         |:|:.|:                                    
 Worm    71 CRLAPAKIGDSCQ---------RDCKPPLLCRDGKCECWGGSIVDGKCVVLCPVGQQLYGVECTR 126

  Fly   452 --QYHLSCTSNSQC-SPFGA------------------SYCHPEIP----RRCTCEEYALYDAIK 491
              .|...|..:||| .||.|                  .:||...|    .|.||....:.| |.
 Worm   127 VAHYQQPCEKDSQCVDPFNACIAGTCLCAPGTTRDTERGFCHATCPDGMHPRQTCRRLFIND-ID 190

  Fly   492 QLCEYKRGLGAECESNDGCPVDH------SVCSNRVCVCADNYFEKDDQCMRGIGADCSVEDDCI 550
            .|        ....:.|.||:.:      |......|.....|.|.|  ..:...|..|.:..|.
 Worm   191 ML--------ENAANTDSCPLGYRCVTYGSPYVGHCCRLRCPYGEPD--LSQSCDAGASPDSKCR 245

  Fly   551 PENTECQEKDEED-QSRTC---QCRKG---YVHFKDECLKEAEELEDECVEDEQCKPLLASCNSE 608
            |....|....|.. :|..|   .||..   ||:  .:||..|.. .|.|..|:||:..:....:.
 Worm   246 PLTHFCFTVSEPGWKSSLCCPRPCRDPTPLYVN--GQCLSIAHR-GDPCQIDQQCEGGITMSCTL 307

  Fly   609 GKCGC-------NDEQH------------AKNGVCETKRELGESCTKATECYVEKDPENVECRNS 654
            |.|.|       |||:.            |.|..|..|.:||..|....:|.     ::.|||..
 Worm   308 GSCQCKLGYHENNDERFLTCTKDCTLEEVASNDRCLAKVQLGARCYSNKQCI-----QSAECRFG 367

  Fly   655 VCQCKLGYSANANQ 668
            .|||:.||....:|
 Worm   368 TCQCRCGYKQVKDQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 20/75 (27%)
EB 613..665 CDD:279949 20/70 (29%)
M03F4.6NP_508843.1 EB 113..160 CDD:279949 8/46 (17%)
EB 272..321 CDD:279949 13/51 (25%)
EB 331..381 CDD:279949 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.