DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and Dkk3

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_612528.2 Gene:Dkk3 / 171548 RGDID:621846 Length:348 Species:Rattus norvegicus


Alignment Length:317 Identity:60/317 - (18%)
Similarity:99/317 - (31%) Gaps:102/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 DTEPLISPRSHEIAVQTSIEKYELREVGRSVRNAATATTTTTATAST-------STSSRRNSSRN 328
            :.|.|:....|::  ::::|:.|..|        |.|.|::..|.|:       .|::......|
  Rat    53 EVEELMEDTQHKL--RSAVEEMEAEE--------AAARTSSEVTLSSLPANYHNETNTETRMENN 107

  Fly   329 QRHAHGQRRRL------PALFR-------FDDEDIKTYSTLGSSRDDDDADEKKY---------G 371
            ..|.|.:..::      ..:|.       .|.|..|::..:    .|:|....:|         .
  Rat   108 TAHVHREVHKITNNQSGQTVFSETVITSVEDGEGKKSHECI----IDEDCGPTRYCQFSSFKYTC 168

  Fly   372 SSCTDNGKTCSGLPHSICSKNICL---CRQGYYARNGKCFAELGEIAESTDECEYEFDQLTKTCN 433
            ..|.|....|: .....|...:|.   |.|  .|..|    ..|.|.::..:|     |....|.
  Rat   169 QPCRDQQMLCT-RDSECCGDQLCAWGHCTQ--KATKG----SNGTICDNQRDC-----QPGLCCA 221

  Fly   434 CQKNYFY--------ERDLRNCRKPIQYHLS----------------CTSNSQCSPFGAS---YC 471
            .|:...:        |.:|  |..|....|.                |.|...|.|...|   .|
  Rat   222 FQRGLLFPVCTPLPVEGEL--CHDPTSQMLDLITWELEPEGALDRCPCASGLLCQPHSHSLVYMC 284

  Fly   472 HP------------EIPRRC--TCEEYALYDAIKQ-LCEYKRGLGAECESNDGCPVD 513
            .|            ::||..  ..|:......::| |.:.:|.|..|....:..|||
  Rat   285 KPAFVGSHDHNEESQLPREALDDYEDVGFIGEVRQELEDLERSLAQEMAFEEATPVD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949
EB 613..665 CDD:279949
Dkk3NP_612528.2 Dickkopf_N 147..196 CDD:282549 8/53 (15%)
Prokineticin <208..273 CDD:148298 11/71 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.