DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and Dkk1

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_034181.2 Gene:Dkk1 / 13380 MGIID:1329040 Length:272 Species:Mus musculus


Alignment Length:213 Identity:48/213 - (22%)
Similarity:70/213 - (32%) Gaps:59/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 YSTLGSSRDDDDADEKKYGSS--CTDNGKTCSGLPHSICSKNICL-CRQ-------------GYY 401
            |.||.:.:....|::::.||.  |:...:..:|    :....||| ||:             |.|
Mouse    75 YQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAG----VGGVQICLACRKRRKRCMRHAMCCPGNY 135

  Fly   402 ARNGKCFAE------LGEIAESTDECEYEFDQLTKTCNCQKNYFYERDLRNCRKPIQYHLS---- 456
            .:||.|...      .|||.||.      .:.|....|......|.|  |.......||..    
Mouse   136 CKNGICMPSDHSHFPRGEIEESI------IENLGNDHNAAAGDGYPR--RTTLTSKIYHTKGQEG 192

  Fly   457 --CTSNSQCSP-------FGASYCHPEIPRRCTCEEYALYDA----IKQLCEYKRGLGAECESND 508
              |..:|.|:.       |.:..|.|.:.....|.::....:    |.|.|....||....:.  
Mouse   193 SVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQK-- 255

  Fly   509 GCPVDHSVCSN--RVCVC 524
                ||...||  |:..|
Mouse   256 ----DHHQASNSSRLHTC 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949
EB 613..665 CDD:279949
Dkk1NP_034181.2 Dickkopf_N 86..142 CDD:282549 14/59 (24%)
DKK-type Cys-1 86..141 14/58 (24%)
DKK-type Cys-2 195..269 17/79 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.