DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and AgaP_AGAP001390

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_321746.5 Gene:AgaP_AGAP001390 / 1281787 VectorBaseID:AGAP001390 Length:359 Species:Anopheles gambiae


Alignment Length:285 Identity:64/285 - (22%)
Similarity:108/285 - (37%) Gaps:64/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 IAESTDEC-------EYEFDQLTKTCNCQKNYFYERDLRNCRKPIQYHLS----CTSNSQCS--- 464
            :..:.|||       .|........|:|...||...|..|.|:.::....    |..|.||.   
Mosquito    60 VCRTDDECPLQAYCERYNSVHEYGVCSCMAGYFAVTDSNNTRRCLRAATDIGDYCLHNDQCQYTL 124

  Fly   465 PFGASYCHPEIPRRCTCEEYALYDAIKQLCEYKRGLGAECESNDGCPVDHSVCSNRVCVCADNYF 529
            ..|.|.|.   ...|.|.:.|.|...::.|.....||..|...:.|..:.:.|.:.:|||.....
Mosquito   125 STGNSECR---DNSCQCVDGAHYVEREKRCYKTSYLGEYCRLTNNCIGNDTYCRDGICVCTPGKH 186

  Fly   530 EKDD--QCMRG--IGADCSVEDDCIPENTECQEKDEEDQSRTCQCRKGYV--HFKDECLKEAEEL 588
            ...|  :|:..  :|..|..:::|:.:|:.|.::       .|.||..:|  ..::.||..|.::
Mosquito   187 PNADRNRCLHDAKLGDQCFRDEECVTDNSRCAQE-------ICTCRVSHVLNEQRNRCLPIASKI 244

  Fly   589 EDECVEDEQCKPLL--ASCN--------SEGKCGCNDEQHAK----------NGVCETKRELGES 633
            .|.|.|:.||...:  :.|.        :.|:|.|....|..          ||:|    |:.::
Mosquito   245 YDLCEENIQCLYNIPHSQCRITTGTDGITAGRCTCASRFHEAGFKCVSSVHLNGIC----EVNDN 305

  Fly   634 CTKATECYVEKDPENVECRNSVCQC 658
            |       :::|   ..|.:..|:|
Mosquito   306 C-------IDRD---TGCYHGRCRC 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 18/75 (24%)
EB 613..665 CDD:279949 11/56 (20%)
AgaP_AGAP001390XP_321746.5 EB 144..191 CDD:279949 10/46 (22%)
EB 279..331 CDD:279949 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.