DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7381 and dkk3b

DIOPT Version :9

Sequence 1:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001083014.1 Gene:dkk3b / 100038765 ZFINID:ZDB-GENE-061207-74 Length:283 Species:Danio rerio


Alignment Length:381 Identity:78/381 - (20%)
Similarity:113/381 - (29%) Gaps:177/381 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 VGRSVRNAATATTTTTATASTSTSSRRNSSRNQRH-AHGQRRRLPALFR-----FDDEDIK---- 351
            ||.||...|....:.|.               :.| |||| ..|..:||     .:|...|    
Zfish    15 VGSSVHRGAHLDISDTL---------------EEHVAHGQ-TTLNEMFREVEKLMEDTQHKLEEA 63

  Fly   352 -------TYSTLGSSRD------DDDADEKKYGSSC----------TDN--GKTCSGLPHSICSK 391
                   |.::|.:.||      |:...|.|.|:..          |||  |||           
Zfish    64 VHQMENETTNSLLNGRDFPDNFHDETTTEIKLGNRTIQLIERINKKTDNKTGKT----------- 117

  Fly   392 NICLCRQGYYARNGKCFAELGEIAESTDECEYEFDQLTKTCNCQKNYFYERDLRNCRKPIQYHLS 456
                    :::|.      |.:..|..:|.::|                                
Zfish   118 --------HFSRT------LIQNTERWNEVDHE-------------------------------- 136

  Fly   457 CTSNSQCSPFGASYCHPEIPRRCTCEEYALYDAIKQLCEYKRGLGAECE-SNDGCPVDHSVCSNR 520
            |..:..|.  ..|:|              ||:.:...|       ..|: :|..|..|...|.::
Zfish   137 CMIDEDCG--DGSFC--------------LYEIVTSKC-------VPCQTTNMECTKDVECCGDQ 178

  Fly   521 VC---VCADNYFEKDDQCMRGIGADCSVEDDCIPEN----------TECQEKDEEDQSRTCQCRK 572
            :|   |||.|..:...      |..|..::||.|::          ..|:.|.:|.|.       
Zfish   179 LCVWGVCAQNKTKGQS------GTICQNQNDCSPQHCCAFHKALLFPVCRPKPQEGQG------- 230

  Fly   573 GYVHFKDECLKEAEEL------EDECVEDEQCKPLLAS--CNSEGKCG-CNDEQHA 619
                    |.:|..:|      |||... |.| |..|.  |....|.. |.||:||
Zfish   231 --------CEREGNQLMEVLLWEDEGPR-EHC-PCAAGLLCQQIQKSSVCVDERHA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 17/59 (29%)
EB 613..665 CDD:279949 5/7 (71%)
dkk3bNP_001083014.1 Dickkopf_N 137..186 CDD:282549 14/71 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.