DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grsm and S-Lap7

DIOPT Version :9

Sequence 1:NP_731749.3 Gene:grsm / 41587 FlyBaseID:FBgn0040493 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001260959.1 Gene:S-Lap7 / 36524 FlyBaseID:FBgn0033868 Length:527 Species:Drosophila melanogaster


Alignment Length:341 Identity:94/341 - (27%)
Similarity:140/341 - (41%) Gaps:62/341 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 TRAI------RMTARIVDMPCNEMNVDHFIQEVEDVGRELC---ITPKVIRGEELLEQGFGGIYG 371
            ||.|      .:..|:.|.|.|.|....|.|...|.   ||   ||.:|...:.:..|.......
  Fly   194 TRGIFKAEAQNLARRLSDAPANCMTPTMFAQAAVDA---LCPCGITVEVRTMDWIEAQRLNAFLM 255

  Fly   372 VGKAAAVPPALVVLSH---EPKGAQETIALVGKGIVYDTGGLSIKAKTGMPGMKRDCGGAAAILG 433
            :.|.:..||.|:.||:   .|.  .:.|..|||||.:::|.|:::...||...:.....||..:.
  Fly   256 IAKGSCEPPVLLELSYCGTAPD--DKPILFVGKGITFNSGALNLRPCRGMDEYRGSMSAAACCVA 318

  Fly   434 TFYAAVQCGFRDNLHAVFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCYAN 498
            ............|:..:..|.||.....:.:|.|:.||.:|:::.|.:.|..|.:||:|.:.|..
  Fly   319 MMRCIAALSLPINVTCIIPLCENMPSGMSAKPGDVVTLLNGKSMAIRDLDKAGVVVLSDPLLYGQ 383

  Fly   499 KDLKANIILDMATL-TGAQ----GVATGKYHGAILTNSE-TWEAKSLQ-AGRKSGDLL--APIIY 554
            |.....:::|:||| ||.:    |.|||     |.:||. .|  |..| ||..|||.:  .|:  
  Fly   384 KTYLPRLVVDIATLNTGVKKAFGGGATG-----IWSNSHYIW--KQFQRAGSISGDRVWRLPL-- 439

  Fly   555 CPELHFSEFASAIADMKNSVADRQN----AQSSCAGLFIAAHLGFDYPGI-WMHVDMATPVHCGE 614
                 :..:...:.|.:  ..|..|    ..|||....|...|   .|.: |.|:|        .
  Fly   440 -----WQYYRRQVTDER--AYDLSNNGRGLASSCLAAAILHEL---VPCVDWAHLD--------T 486

  Fly   615 RATG----YGVSLLLT 626
            |.||    ||:...||
  Fly   487 RGTGLLSKYGLVPYLT 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grsmNP_731749.3 Peptidase_M17 141..628 CDD:238247 94/341 (28%)
S-Lap7NP_001260959.1 PRK00913 36..518 CDD:234863 94/341 (28%)
Peptidase_M17 39..518 CDD:238247 94/341 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472722
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.