DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grsm and S-Lap5

DIOPT Version :9

Sequence 1:NP_731749.3 Gene:grsm / 41587 FlyBaseID:FBgn0040493 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_610892.1 Gene:S-Lap5 / 36515 FlyBaseID:FBgn0033860 Length:549 Species:Drosophila melanogaster


Alignment Length:325 Identity:89/325 - (27%)
Similarity:139/325 - (42%) Gaps:48/325 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 MTARIVDMPCNEMNVDHFIQEVEDVGRELC---ITPKVIRGEELLEQG-FGGIYGVGKAAAVPPA 381
            :..|:.|.|.|:|....|.|...|.   ||   ::.:| |..:.:|.. ......:.|.:..||.
  Fly   227 LARRLSDSPANQMTPTIFAQSAVDA---LCPCGVSVEV-RSMDWIEMNHLNSFLMIAKGSCEPPV 287

  Fly   382 LVVLSHEPKGAQE-TIALVGKGIVYDTGGLSIKAKTGMPGMKRDC-GGAAAILGTFYAAVQCGFR 444
            ::.:|:.....:: .|.|:|||:.|::|||.::.|..: .|.|.| .|||..:....||......
  Fly   288 VLEVSYCGTAPEDRPILLLGKGLTYNSGGLCLRPKDCL-HMYRGCMAGAAVCVAAVRAAAALSLP 351

  Fly   445 DNLHAVFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCYANKDLKANIILDM 509
            .|:.||..|.||.....|.:|.|:.||.:|:|:.|.:....|.:||||.:.:|....|..:::|:
  Fly   352 VNITAVLPLCENMPSGMAVKPGDVVTLLNGKTMGIVDVSKAGTVVLADPLLFAQTTYKPRLVVDL 416

  Fly   510 ATLTGAQGVATGKYHGA--ILTNSETWEAKSLQAGRKSGDLL--API------IYCPELHFSEFA 564
            ||:  ..||..|....|  :.|||.....:..:||..:||.|  .|:      :..|.|.|    
  Fly   417 ATV--GYGVCAGLGESAAGLFTNSNFIAKQFEKAGGLTGDRLWRLPLWRYFKQLVTPNLTF---- 475

  Fly   565 SAIADMKNSVADRQNAQSSCAGLFIAAHLGFDYP-GIWMHVDMAT----------PVHCGERATG 618
                |:.|...   ...|||....:...|   .| ..|.|:|:..          |....:|.||
  Fly   476 ----DISNRGI---GPASSCIAAAVLHEL---VPCADWAHIDIRNVGMLTRHNPLPYLLKDRMTG 530

  Fly   619  618
              Fly   531  530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grsmNP_731749.3 Peptidase_M17 141..628 CDD:238247 89/325 (27%)
S-Lap5NP_610892.1 Peptidase_M17 60..540 CDD:238247 89/325 (27%)
PepB 83..544 CDD:223338 89/325 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472720
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3211
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.