DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grsm and SPAC13A11.05

DIOPT Version :9

Sequence 1:NP_731749.3 Gene:grsm / 41587 FlyBaseID:FBgn0040493 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_592993.1 Gene:SPAC13A11.05 / 2542130 PomBaseID:SPAC13A11.05 Length:513 Species:Schizosaccharomyces pombe


Alignment Length:400 Identity:120/400 - (30%)
Similarity:182/400 - (45%) Gaps:62/400 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 LVKNHVLNVSEESVVLVCERENLFASACAVVRAFPLYSRKTGNLLASSQPKLNLGCGDGNANSGR 283
            |.::|:....:|.||   |:||||.|        |...|.|..||:::..|       ..|.:..
pombe   135 LRRDHLSVYQDEKVV---EKENLFTS--------PAPERLTFQLLSNTSEK-------KTATAEE 181

  Fly   284 NVVNVEFVLINKDGCIESEPLTDDELNCLNETTRAIRMTARIVDMPCNEM---NVDHFIQEVEDV 345
            |...|        |.||:               .|..:...:::.|.|.|   ...||.||:...
pombe   182 NAFKV--------GLIEA---------------AAQNLARSLMECPANYMTSLQFCHFAQELFQN 223

  Fly   346 GRELCITPKVIRGEE--LLEQGFGGIYGVGKAAAVPPALVVLSHEPKGAQET---IALVGKGIVY 405
            ..::    ||...:|  :.||...|:..|...:.:||..:.:.:..|...:.   :.|||||:.:
pombe   224 SSKV----KVFVHDEKWIDEQKMNGLLTVNAGSDIPPRFLEVQYIGKEKSKDDGWLGLVGKGVTF 284

  Fly   406 DTGGLSIKAKTGMPGMKRDCGGAAAILGTFYAAVQCGFRDNLHAVFCLAENSVGPNATRPDDIHT 470
            |:||:|||....|..|:.|.||||.:|.:.||..|.....|...|..|.||....:|.:|.|:..
pombe   285 DSGGISIKPSQNMKEMRADMGGAAVMLSSIYALEQLSIPVNAVFVTPLTENLPSGSAAKPGDVIF 349

  Fly   471 LYSGRTVEINNTDAEGRLVLADGVCYANKDLKANIILDMATLTGAQGVATGK-YHGAILTNSETW 534
            :.:|.:|||:||||||||:|||.|.|.:...|...:::.:|||||..||.|. :.||.:...|.|
pombe   350 MRNGLSVEIDNTDAEGRLILADAVHYVSSQYKTKAVIEASTLTGAMLVALGNVFTGAFVQGEELW 414

  Fly   535 EAKSLQ-AGRKSGDLLAPIIYCPELHFSEF-ASAIADMKNSVADRQNAQSSCAGLFIAAHLGFDY 597
              |:|: |...:|||...:.: .|.:..:. :|:.||:.|  ..|.......|..||...|. ..
pombe   415 --KNLETASHDAGDLFWRMPF-HEAYLKQLTSSSNADLCN--VSRAGGGCCTAAAFIKCFLA-QK 473

  Fly   598 PGIWMHVDMA 607
            ...:.|:|:|
pombe   474 DLSFAHLDIA 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grsmNP_731749.3 Peptidase_M17 141..628 CDD:238247 119/399 (30%)
SPAC13A11.05NP_592993.1 PepB 14..513 CDD:223338 119/399 (30%)
Peptidase_M17 31..508 CDD:238247 119/399 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55148
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1683
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.