DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp304a1 and AT1G66540

DIOPT Version :9

Sequence 1:NP_731751.1 Gene:Cyp304a1 / 41586 FlyBaseID:FBgn0038095 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_176827.2 Gene:AT1G66540 / 842972 AraportID:AT1G66540 Length:386 Species:Arabidopsis thaliana


Alignment Length:357 Identity:88/357 - (24%)
Similarity:152/357 - (42%) Gaps:48/357 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 RRFDQLELVIQEQLNDMLDLIRNGPKYPHEHEMVKSGGYRVLLPLLFNPFSANAHFYIVYNECLS 207
            ||...:|:....:||....:.|:..:             |::..|..:|.::.....:..|..||
plant    14 RRIGAVEIFSNHRLNSFYTIRRDEIR-------------RLIARLSRSPNASLEFAKVEMNSMLS 65

  Fly   208 REEMGKLVKLCQMGIQFQRNADD-------------------YGKMLSIIPWIRHIWPEWSGYNK 253
            ......::::......:...|:|                   .|.....:|.:|     |....:
plant    66 NLAFNNIIRMVTGKCYYGDGAEDDPEAKRVRQLIAEAMSCFGAGHAADHLPMLR-----WITDFE 125

  Fly   254 LNESNLFVR--QFFADFVDKYLDSYEEGVERNFMDVYIAEMRRGPGYGFNRDQLIMG-LVDFSFP 315
            .....:..|  :||...||:...: :|..|...:|..::.....|.|  ..|..|.| ::.....
plant   126 RRVKKIAARLDEFFQRLVDEKRVA-KEKKENTMIDHLLSLQVSQPEY--YTDHTIKGTMLSLILA 187

  Fly   316 AFTAIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCGRLPNLEDRKNLPFTEATIREGLRIETLV 380
            ......|.|...:..|:..|.||::|::|||..:|..||....|..|||:.:..:.|.||:....
plant   188 GTDTSAVTLEWALSSLLNNPEVLKKVRDEIDNQIGLDRLLEESDIPNLPYLQNIVSETLRLYPAG 252

  Fly   381 PSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFRPERFLDADGKLCLKLDVSL 445
            |..|||.:.||.::.||.:|..|:::.:::|.|.|.|:|.||..|:|||| :.:|: ..||   |
plant   253 PLLVPHISSEDCKVGGYDMPCGTMLLVNVWAIHRDPRLWDDPASFKPERF-EKEGE-THKL---L 312

  Fly   446 PFGAGKRLCAGETFARNMLFLVTATMCQHFDF 477
            .||.|:|.|.|...||.::.|...::.|.|::
plant   313 TFGLGRRACPGSGLARRLVSLSLGSLIQCFEW 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp304a1NP_731751.1 p450 30..504 CDD:278495 88/357 (25%)
AT1G66540NP_176827.2 p450 <4..375 CDD:386267 88/357 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.