DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp304a1 and CYP76C6

DIOPT Version :9

Sequence 1:NP_731751.1 Gene:Cyp304a1 / 41586 FlyBaseID:FBgn0038095 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_174633.1 Gene:CYP76C6 / 840263 AraportID:AT1G33720 Length:511 Species:Arabidopsis thaliana


Alignment Length:517 Identity:136/517 - (26%)
Similarity:230/517 - (44%) Gaps:84/517 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ETLLTICAAVFLCLSY------RYAVGRPSGFPPGPPKIPLFGSYLFMLIINFKYLHKAALTLSR 62
            :.|..|...:..||.:      |.:..:.|..|||||::|:.|:    :.:..|..|.:...||:
plant     7 QPLFLIFCFILSCLLFFTTARSRRSPCQLSKSPPGPPRLPIIGN----IHLVGKNPHHSFTDLSK 67

  Fly    63 WYKSDIIGLHVGPFPVAVVHSADGVREIL--NNQVFDGRPQLFVAAMRDPGQDVRGIFFQDGPLW 125
            .| ..::.|.:|.....|:.|.|.|||:|  ::|:..||   :::..........   |..|.:.
plant    68 TY-GPVMSLKLGCLNSVVIASRDAVREVLKTHDQILSGR---YISEATKSNNHHE---FSVGWIH 125

  Fly   126 KEQRRFILRYLRDFGFGRRFD--------QLEL-VIQEQLNDMLDLIRNGPKYPHEHEMVKSGGY 181
            ....||  |.||.....:.|.        .|.: .:||.:|.:.:....     .|...:....:
plant   126 PSSSRF--RMLRKLSATQLFSPQCIQATKALRMKKVQELVNFLSESCER-----EEAVDISHVSF 183

  Fly   182 RVLLPLLFN-PFSANAHFYIVYNECLSREEMGKLVKLCQMGIQFQR---NADDYGKMLSIIPWIR 242
            ...|.::.| .||.|...|...|....:|          |.|.:|.   |.|    :.:..|::|
plant   184 VTALNIISNILFSVNLGSYDSKNSSAFQE----------MVIGYQESIGNPD----LANFFPFMR 234

  Fly   243 HIWPEWSGYN-KLNESNLFVRQFFADF-----VDKYLDSYEEGV-ERNFMDVYIAEMRRGPGYGF 300
            .:  :..|.: |:.||:..:.|.|.:|     |:|...|.|:.| .::|:||.| ::::|.....
plant   235 FL--DLQGNSKKMRESSGRLLQVFREFYDARIVEKSSRSVEKDVSSKDFLDVLI-DLQQGDETEI 296

  Fly   301 NRDQLIMGLVDFSFPAFTAIGVQLSLLVQYLML----YPAVLRRVQNEIDEVVGCGRLPNLEDRK 361
            |.|::...|:|. |.|.|...   |..|::.|.    .|..:.:||:||:.|:|........|..
plant   297 NIDEIEHLLLDM-FVAGTDTN---SSTVEWAMAELLGNPKTMTKVQDEINHVIGQNGDFQESDIS 357

  Fly   362 NLPFTEATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFR 426
            .||:.:|.::|..|:....|..:..||..:.|:||:.:.||:.|:.:::|...|..:|.:|..|.
plant   358 KLPYLKAVVKETFRLHPAAPFLLQRKAETNVEILGFTVLKDSQVLVNVWAIGRDPLVWENPTHFE 422

  Fly   427 PERFLDADGKLCLKLDVS------LPFGAGKRLCAGETFARNMLFLVTATMCQHFDFVLGPN 482
            |||||   ||   ::||.      .|||||:|:|.|...|...:.|:.|::...|::.| ||
plant   423 PERFL---GK---EIDVKGTDYELTPFGAGRRICPGLPLAMKTVHLMLASLLYTFEWKL-PN 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp304a1NP_731751.1 p450 30..504 CDD:278495 130/485 (27%)
CYP76C6NP_174633.1 p450 11..504 CDD:299894 135/513 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.