DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp304a1 and CYP71A16

DIOPT Version :9

Sequence 1:NP_731751.1 Gene:Cyp304a1 / 41586 FlyBaseID:FBgn0038095 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_199073.1 Gene:CYP71A16 / 834266 AraportID:AT5G42590 Length:497 Species:Arabidopsis thaliana


Alignment Length:534 Identity:125/534 - (23%)
Similarity:220/534 - (41%) Gaps:114/534 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLTICAAVFL--CLSYRYAVGRP-SGFPPGPPKIPLFGSYLFMLIINFKYLHKAALTLSRWYKSD 67
            |:::|...||  .|.::..:.|| |..||.|.::|:.|: |..|.:   :.|:|..:||..: ..
plant     6 LISLCLTTFLTILLFFKSLLKRPNSNLPPSPWRLPVIGN-LHQLSL---HPHRALSSLSARH-GP 65

  Fly    68 IIGLHVGPFPVAVVHSADGVREIL--NNQVFDGRPQLFVA-AMRDPGQDVRGIFFQDGPLWK--- 126
            ::.|..|..||.:|.|||...:::  ::..|..||....| .:.:.|:|:  :|...|..|:   
plant    66 LMLLRFGRVPVLIVSSADVAHDVMKTHDLKFANRPITKSAHKISNGGRDL--VFAPYGEYWRNVK 128

  Fly   127 ----------------EQRR-----FILRYLRDFGFGRRFDQLELVIQEQLNDMLDLIRNGPKYP 170
                            |:||     .::..|.:.........|..:|...::|::..:..|.||.
plant   129 SLCTIHLLSNKMVQSSEKRREEEITLLMETLEEASLSSSSVNLSKLITNMVSDIMGKVVLGKKYS 193

  Fly   171 HEHEMVKSGGYRVLLPLLFNPFSANAHFYIVYNECLSREEMGKLVK--LCQMGIQFQRNADDYGK 233
            .|...:                                 ::..:.|  |..:|:      ...|:
plant   194 GEEGTI---------------------------------DVKTITKSFLDAVGL------SPVGE 219

  Fly   234 MLSIIPWIRHIWPEWSGYNKLNESNLFVRQFFADFVDKYLDSYEEGV----ERNFMDVYIAEMRR 294
            .:..:.||..|........|:.:.       |.||::|.|..:|:..    ..:|:|:.:.    
plant   220 YIPSLAWIGKITGSDGKLEKITKQ-------FGDFIEKVLQEHEDTTADKETPDFVDMLLT---- 273

  Fly   295 GPGYGFNRDQLIMGLVDFS------FPAFTAIGVQLSLLVQY----LMLYPAVLRRVQNEIDEVV 349
                 ..||:.....:|.|      |..|.......|.::::    ||..|..|:::|:||..|.
plant   274 -----IQRDETAQCQLDKSDLKVIIFEMFLGSTTTTSAVIEWAMTRLMRNPECLKKLQDEIRSVS 333

  Fly   350 GCGRLPNLEDRKNLPFTEATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHS 414
            ......:.::.:|:.:.:|.|:|.||:...:|..||....||.:|.||.|...|.|:.:.:|...
plant   334 KMNSYVSGKEVENMNYLKAVIKEVLRLHPPLPLLVPRLLSEDVKLKGYDITAGTQVIINAWAIQR 398

  Fly   415 DARIW-SDPEQFRPERFLDADGKLCLKLDVSLPFGAGKRLCAGETFARNMLFLVTATMCQHFDFV 478
            |...| ||.::|||||..|:......:....:|||||:|||.|......|..:..|.:.:.||:.
plant   399 DTATWGSDAQEFRPERHFDSTWDFVGRNFKYIPFGAGRRLCPGIGLGSVMASVTLANLVKRFDWR 463

  Fly   479 L--GPN--DRLPDL 488
            :  ||:  |: |||
plant   464 VEDGPSGYDK-PDL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp304a1NP_731751.1 p450 30..504 CDD:278495 117/507 (23%)
CYP71A16NP_199073.1 p450 4..494 CDD:299894 125/534 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.