DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp304a1 and CYP81F3

DIOPT Version :9

Sequence 1:NP_731751.1 Gene:Cyp304a1 / 41586 FlyBaseID:FBgn0038095 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_568025.1 Gene:CYP81F3 / 829894 AraportID:AT4G37400 Length:501 Species:Arabidopsis thaliana


Alignment Length:540 Identity:120/540 - (22%)
Similarity:207/540 - (38%) Gaps:132/540 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLTICAAVFLCLSYR-YAVGRPSGF--PPGPP-KIPLFGSYLFMLIINFKYLHKAALTLSRWYKS 66
            ::.:..|:|| |:|: :...:...|  ||.|| .:|:.|.:..:.....:..|:.:.|     ..
plant     5 VIVLPLALFL-LAYKLFFTSKTKRFNLPPSPPYSLPILGHHNLLKPPVHRLFHRLSKT-----HG 63

  Fly    67 DIIGLHVGPFPVAVVHSADGVREILNNQVFDGRPQLFVAAMRDPGQDVRGIFFQD---------- 121
            .|..|..|.....|:.|:.     |..|.|.|:..:.::.        |..|...          
plant    64 PIFSLQFGSRRAVVISSSS-----LATQCFTGQNDIILSN--------RPCFLTAKYVAYNYTTV 115

  Fly   122 -----GPLWKEQRRFILRYLRDFGFGRRFDQLELVIQEQLNDMLDLIRNGPKYPHEHEMVKSGGY 181
                 |..|:..||..              .||::...:|.:.|.:.::     ..|.|:.....
plant   116 GTAPYGDHWRNLRRIC--------------SLEILSSNRLTNFLHIRKD-----EIHRMLTRLSR 161

  Fly   182 RVLLPLLFNPFSANAHFYIV---------YNECLSREEMGKLVKLCQMGI---QFQRNADDYGKM 234
            .|...:...|..::..|..:         |.:.:..||...:.|.....|   ...|:..||   
plant   162 DVNKEIELEPLLSDLTFNNIVRMVTGKRYYGDEVHNEEEANVFKKLVADINDCSGARHPGDY--- 223

  Fly   235 LSIIPWIRHIWPEWSGYNKLNESNLFVRQF------FADFVDKYLDSYEEGVER----NFMDVYI 289
               :|:::                :|...|      .|:.:|:.|....|..:|    |.|..::
plant   224 ---LPFMK----------------MFGGSFEKKVKALAEAMDEILQRLLEECKRDKDGNTMVNHL 269

  Fly   290 AEMRRG-PGYGFNRDQLIMGLVDFSFPAFT-AIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCG 352
            ..:::. |.|  ..|..|.||:.....|.| ...|.|...:..|:.:|..|.:.:.||||.:|..
plant   270 LSLQQNEPEY--YTDVTIKGLMLGMMIAGTDTSAVTLEWAMSSLLNHPEALEKAKLEIDEKIGQE 332

  Fly   353 RLPNLEDRKNLPFTEATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDAR 417
            ||.:..|..|||:.:..:.|..|:....|..||....||.::.||.:|:.|:|:.:.:|.|.|..
plant   333 RLIDEPDIANLPYLQNIVSETFRLYPAAPLLVPRSPTEDIKVGGYDVPRGTMVMVNAWAIHRDPE 397

  Fly   418 IWSDPEQFRPERFLDADG--------KLCLKLDVSLPFGAGKRLCAGETFARNMLFLVTATMCQH 474
            :|::||:|:||||...:|        ||       :|||.|:|.|.|....:.::.|...::.|.
plant   398 LWNEPEKFKPERFNGGEGGGRGEDVHKL-------MPFGNGRRSCPGAGLGQKIVTLALGSLIQC 455

  Fly   475 FDFVLGPNDRLPDLSQNLNG 494
            ||:            |.:||
plant   456 FDW------------QKVNG 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp304a1NP_731751.1 p450 30..504 CDD:278495 114/513 (22%)
CYP81F3NP_568025.1 p450 40..482 CDD:299894 109/504 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.