DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp304a1 and CYP71B32

DIOPT Version :9

Sequence 1:NP_731751.1 Gene:Cyp304a1 / 41586 FlyBaseID:FBgn0038095 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_680127.1 Gene:CYP71B32 / 824498 AraportID:AT3G53305 Length:338 Species:Arabidopsis thaliana


Alignment Length:460 Identity:98/460 - (21%)
Similarity:151/460 - (32%) Gaps:180/460 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LHVGPFPVAVVHSADGVREILNNQVFD--GRPQ-----LFVAAMRDPGQDVRGIFFQDGPLWKEQ 128
            |..|..||.|..|.:..:|:|.....|  .||:     ||....:|.|      |.|.|..|:|.
plant     3 LRFGVVPVVVFSSKEAAKEVLKTHDLDTCTRPKLVANGLFSRNFKDIG------FTQYGEDWREM 61

  Fly   129 RRFI------------LRYLRDFGFGRRFDQLELVIQEQLNDMLDLIRNGPKYPHEHEMVKSGGY 181
            ::.:            .||:|:       ::.:|::::..|                    |...
plant    62 KKLVGLELFSPKKHKSFRYIRE-------EEGDLLVKKISN--------------------SAQT 99

  Fly   182 RVLLPLLFNPFSANAHFYIVYNECLSREEMGKLVKLCQMGIQFQRNADDYGKMLSIIPWIRHIWP 246
            :.|:.|....||..|               |.:.:|. .|..|.:                    
plant   100 QTLIDLRKASFSFTA---------------GTIFRLA-FGQNFHQ-------------------- 128

  Fly   247 EWSGYNKLNESNLFVRQFFADFVDKYLDSYEEGV---ERNFMDVYIAEMRRGPGYGFNRDQLIMG 308
                               .||:|  :|..||.|   |.|                    ..|:.
plant   129 -------------------CDFMD--MDRLEELVLEAETN--------------------GCILA 152

  Fly   309 LVDFSFPAFTAIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCG-----RLPNLEDRKNLPFTEA 368
            |.|| .|  |.:|        :|             :|.:.|||     ...|..|.:.:.:...
plant   153 LTDF-LP--TGLG--------WL-------------VDRISGCGFGGSECGNNHNDLQKVEYLNM 193

  Fly   369 TIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFRPERFLDA 433
            .|:|..|:....|..:|.:.:.|.|:.||.|||:.::..:.|....|.:.||:     |||||:.
plant   194 VIKETFRLHPPSPLLLPRETMSDIEIQGYHIPKNALIRINTYTIGRDLKCWSN-----PERFLNT 253

  Fly   434 -------DGKLCLKLDVSLPFGAGKRLCAGETFARNMLFLVTATMCQHFDFVLGPNDRLPDLSQN 491
                   |.||       ||||||:|.|.|......:|.|....:...||:.......:.|:...
plant   254 SINYKGQDYKL-------LPFGAGRRSCPGMNLGITILELGLLNILYFFDWSFPNGMTIEDIDME 311

  Fly   492 LNGLI 496
            .||.:
plant   312 ENGAL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp304a1NP_731751.1 p450 30..504 CDD:278495 98/460 (21%)
CYP71B32NP_680127.1 p450 3..311 CDD:299894 96/453 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.