DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp304a1 and CYP71B38

DIOPT Version :9

Sequence 1:NP_731751.1 Gene:Cyp304a1 / 41586 FlyBaseID:FBgn0038095 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_190011.1 Gene:CYP71B38 / 823550 AraportID:AT3G44250 Length:499 Species:Arabidopsis thaliana


Alignment Length:525 Identity:126/525 - (24%)
Similarity:222/525 - (42%) Gaps:113/525 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AVFLC---------LSYRYAVGRPSGFPPGPPKIPLFGSYLFMLIINFKYLHKAALTLSRWYKSD 67
            ::|||         :.::..:......||||..:|:.|:...:..:.:|..||    :|:.| ..
plant     2 SIFLCFLLLLPLSLILFKKLLPSKGKLPPGPIGLPIIGNLHQLGKLLYKSFHK----ISQEY-GP 61

  Fly    68 IIGLHVGPFPVAVVHSADGVREILNNQVFD--GRPQ-----LFVAAMRDPGQDVRGIFFQDGPLW 125
            ::.|.:|..||.||.|.:|..|:|.....:  .||:     ||....:|.|      |...|..|
plant    62 VVLLRLGVVPVIVVSSKEGAEEVLKTHDLETCTRPKTAATGLFTYNFKDIG------FAPFGDDW 120

  Fly   126 KEQRR------FILRYLRDFGFGRRFDQLELVIQ-------EQLNDMLDLIRNGPKYPHEHEMVK 177
            :|.|:      |.::.|:.|.:.|. ::.||:::       |..|..:||          .:::.
plant   121 REMRKITTLELFSVKKLKSFRYIRE-EESELLVKKISKSVDETQNSSVDL----------RKVLF 174

  Fly   178 SGGYRVLLPLLFNPFSANAHFYIVYNEC----LSREEMGKLVKLCQMGIQFQRNADDY--GKMLS 236
            |....::..|   .|..|.|      :|    .|.||   ||...:..:.....||.:  |.::.
plant   175 SFTASIICRL---AFGQNFH------QCDFVDASLEE---LVLESEANLGTFAFADFFPGGWLID 227

  Fly   237 IIPWIRHIWPEWSG-YNKLNESNLFVRQFFADFVDKYLDSYEEGVERNFMDV------YIAEMRR 294
            .|          || ::::|::...:..|:...:|.:|   :.|..::..|:      .|.:..:
plant   228 RI----------SGQHSRVNKAFYKLTNFYKHVIDDHL---KTGQPQDHSDIVSVMLDMINKPTK 279

  Fly   295 GPGYGFNRDQLIMGLVDFSFPAFTAIGVQLSL-LVQYLMLYPAVLRRVQNEIDEVVGCGRLPNL- 357
            ...:....|.| .|::...|.|....|....: .:..|..:|.|::::|.||..::|    ||. 
plant   280 ADSFKVTYDHL-KGVMSDIFLAGVNGGANTMIWTLTELSRHPRVMKKLQEEIRAMLG----PNKE 339

  Fly   358 ----EDRKNLPFTEATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARI 418
                ||.:.:.:.:..:.|..|:....|..:|...:.|.::.||.|||:|::..:.||...|.:.
plant   340 RITEEDLEKVEYLKLVMVETFRLHPPAPLLLPRLTMSDIKIQGYNIPKNTMIQINTYAIGRDPKY 404

  Fly   419 WSDPEQFRPERFLDADGKLCLKLDVS------LPFGAGKRLCAGETFARNMLFLVTATMCQHFDF 477
            |..|.:|.||||||:      .:|..      ||||||:|:|.|......|:.|....:...||:
plant   405 WKQPGEFIPERFLDS------PIDYKGQHFELLPFGAGRRICPGMATGITMVELGLLNLLYFFDW 463

  Fly   478 VLGPN 482
            .| ||
plant   464 SL-PN 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp304a1NP_731751.1 p450 30..504 CDD:278495 123/498 (25%)
CYP71B38NP_190011.1 p450 27..497 CDD:386267 123/500 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.