DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp304a1 and Cyp2d40

DIOPT Version :9

Sequence 1:NP_731751.1 Gene:Cyp304a1 / 41586 FlyBaseID:FBgn0038095 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_076112.2 Gene:Cyp2d40 / 71754 MGIID:1919004 Length:338 Species:Mus musculus


Alignment Length:248 Identity:80/248 - (32%)
Similarity:123/248 - (49%) Gaps:10/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 FADFVDKYLDSYE-----EGVERNFMDVYIAEM---RRGPGYGFNRDQLIMGLVDFSFPAFTAIG 321
            |...|||.:..::     :...|:..|.::|||   :..|...||...|.:.::|..........
Mouse    88 FLTMVDKLVTEHKRTWDPDQPPRDLTDAFMAEMETAKGNPESSFNEANLRLVVLDLFGGGIVTTS 152

  Fly   322 VQLSLLVQYLMLYPAVLRRVQNEIDEVVGCGRLPNLEDRKNLPFTEATIREGLRIETLVPSDVPH 386
            ..|:..:..::|:|.|.||||.|||||:|..|.|.:.|:..:|:|.|.|.|..|...:.|..:||
Mouse   153 ATLTWALLLMILHPDVQRRVQEEIDEVIGQARRPEMADQARMPYTNAVIHEVQRFADIAPMTLPH 217

  Fly   387 KALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFRPERFLDADGKLCLKLDVSLPFGAGK 451
            :...|.|:.|:.|||.|.::.:|.:...|..:|..|.:|.||.||||.|.. :|.:..:||.||:
Mouse   218 RTSCDIEVQGFLIPKGTTLICNLSSVLKDETVWEKPLRFYPEHFLDAQGHF-VKPEAFMPFSAGR 281

  Fly   452 RLCAGETFARNMLFLVTATMCQHFDFVLGPNDRLPDLSQNLNGLIISPPDFWL 504
            |.|.||...|..|||....:.|.|.|.:.....||. ...:..:::||..:.|
Mouse   282 RACLGEPLVRMELFLFFTCLLQRFSFSVPDGQPLPS-DYGIYSMVVSPAPYQL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp304a1NP_731751.1 p450 30..504 CDD:278495 79/246 (32%)
Cyp2d40NP_076112.2 p450 <54..334 CDD:278495 80/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.