DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp304a1 and Cyp2t1

DIOPT Version :9

Sequence 1:NP_731751.1 Gene:Cyp304a1 / 41586 FlyBaseID:FBgn0038095 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_599196.2 Gene:Cyp2t1 / 171380 RGDID:620086 Length:497 Species:Rattus norvegicus


Alignment Length:529 Identity:146/529 - (27%)
Similarity:234/529 - (44%) Gaps:52/529 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIT--ETLLTICAAVFLCLSYRYAVGR-----PSGFPPGPPKIPLFGSYLFMLIINFKYLHKAAL 58
            |:|  .|||.:.....:.:|:.:...:     ....||||..:||.|:   :|.:...:|.:..:
  Rat     1 MVTCEATLLLLLILTLMLMSWGWLAHQARARMQKDLPPGPAPLPLLGN---LLQLQSGHLDRVLM 62

  Fly    59 TL-SRWYKSDIIGLHVGPFPVAVVHSADGVRE--ILNNQVFDGRPQLFVAAMRDPGQDVRGIFFQ 120
            .| |||  ..:..:.:||.|..|:.....:|:  :|....|.||..:.|......|   .||.|.
  Rat    63 ELSSRW--GPVFTVWLGPRPAVVLSGYAALRDALVLQADAFSGRGSMAVFERFTHG---NGIVFS 122

  Fly   121 DGPLWKEQRRFILRYLRDFGFGRRFDQLELVIQEQLNDMLDLIRNGPKYPHE-HEMVKSGGYRVL 184
            :||.|:..|.|.|..|::||.|.  ..:|..|.|:...:||..:.....|.: ..::.:....|:
  Rat   123 NGPRWRTLRNFALGALKEFGVGT--STIEERILEETACVLDEFQATMGAPFDPRRLLDNAVSNVI 185

  Fly   185 LPLLFNPFSANAHFYIVYNECLSREEMGKLVKLC--QMGIQFQRNADDYGKMLSIIPWIRHIWPE 247
            ..::|..         .||  ....|..:|:.|.  ...|...|..:.|....|.:.||.  .|.
  Rat   186 CTVVFGK---------RYN--YGDPEFLRLLDLFSDNFRIMSSRWGETYNMFPSFMDWIP--GPH 237

  Fly   248 WSGYNKLNESNLFVRQFFADFVDKYLDSYEEGVERNFMDVYIAEM---RRGPGYGFNRDQLIMGL 309
            ...:....|..||:    ::.:..:..|.:.|..|:|:|.::.:|   .:.|...|..:.|:|..
  Rat   238 HRIFKNFQELRLFI----SEQIQWHRQSRQTGEPRDFIDCFLEQMDKEHQDPESHFQDETLVMTT 298

  Fly   310 VDFSF--PAFTAIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCGRLPNLEDRKNLPFTEATIRE 372
            .:..|  ...|:..::..||:  ::.||.|..:||.|:|..||..|.|:|.||.:||:|.|.:.|
  Rat   299 HNLFFGGTETTSTTLRYGLLI--MLKYPEVAAKVQEELDATVGRTRAPSLADRAHLPYTNAVLHE 361

  Fly   373 GLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFRPERFLDADGKL 437
            ..|..:::|..:|...:.|..|..:.:.|.|.|:|.|.:.|.|...:.||:.|.|..|||..|:.
  Rat   362 IQRFISVLPLGLPRALIRDVNLRNHFLHKGTFVIPLLVSAHRDPTQFKDPDHFNPTNFLDDQGEF 426

  Fly   438 CLKLDVSLPFGAGKRLCAGETFARNMLFLVTATMCQHFDF--VLGPNDRLPDLSQNLNGLIISPP 500
             ...|..:||..|||:|.|...||:.:||....:.|.|..  |..|.|  .||:....||...||
  Rat   427 -QNNDAFMPFAPGKRMCLGAGLARSEIFLFLTAILQKFSLLPVGSPAD--IDLTPQCTGLGNVPP 488

  Fly   501 DFWLQLQDR 509
            .|.|:|..|
  Rat   489 AFQLRLVAR 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp304a1NP_731751.1 p450 30..504 CDD:278495 137/486 (28%)
Cyp2t1NP_599196.2 cytochrome_P450 68..492 CDD:425388 125/452 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.