powered by:
Protein Alignment beat-Vb and zgc:172120
DIOPT Version :9
Sequence 1: | NP_001262511.1 |
Gene: | beat-Vb / 41583 |
FlyBaseID: | FBgn0038092 |
Length: | 328 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001121748.1 |
Gene: | zgc:172120 / 799440 |
ZFINID: | ZDB-GENE-080204-46 |
Length: | 273 |
Species: | Danio rerio |
Alignment Length: | 36 |
Identity: | 12/36 - (33%) |
Similarity: | 19/36 - (52%) |
Gaps: | 3/36 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 PQI--VDFRDNVTLSCSYDISGHTLNSVKWYKNGKE 65
|:: ||..|. ||||..::..||.:.:...|:..|
Zfish 158 PEVIWVDEHDQ-TLSCPLELLKHTEDGLYLIKSRYE 192
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.