DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Vb and si:dkey-71p21.13

DIOPT Version :9

Sequence 1:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_001339740.3 Gene:si:dkey-71p21.13 / 799376 ZFINID:ZDB-GENE-090313-327 Length:252 Species:Danio rerio


Alignment Length:234 Identity:42/234 - (17%)
Similarity:80/234 - (34%) Gaps:85/234 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 NECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTARDANMTVEALPQNNPLISSFHSTYRFN 156
            :|.|:.:..:.::.:|:|..|.|.|:|.        ..:.|.                       
Zfish    87 SELNKGNASLRIDGVGLKDEGWYVCKVR--------NKKGAG----------------------- 120

  Fly   157 DFVEVNCSTDFSSLFT--RITWYVNGIKVSLVDLLPSFETTIVAHGYSMRRIVSQLNFYANEPRF 219
               :|....|:.:.::  |::.:.|...|.:     .:||    .|:....::.|...  |:...
Zfish   121 ---KVKIKLDYGAFYSEPRLSIHANSSSVRV-----QYET----EGFPKPEVIWQDEH--NQSLS 171

  Fly   220 HQLQLQKLIQQKRTISPARLGLELRCVAEIDRYP----------HLQREGTMFAQLFRDDIDQKN 274
            |.|:|         :....:||.|...:...:.|          ||              ::||.
Zfish   172 HHLEL---------LDHTEVGLYLVKSSYEAQTPVVKVTFILKNHL--------------LNQKL 213

  Fly   275 QKLINSRSGATPNSQVQHLLL----VAISMTMTAVRLFT 309
            ||.:....|.|.:..:..:||    :.:|..|.|: |||
Zfish   214 QKSVIYIPGDTEDGSIAVILLSLACIILSGLMGAL-LFT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 8/28 (29%)
Ig 41..130 CDD:143165 8/37 (22%)
si:dkey-71p21.13XP_001339740.3 I-set 17..126 CDD:254352 10/72 (14%)
Ig 30..115 CDD:299845 8/35 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.