DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Vb and zgc:153911

DIOPT Version :9

Sequence 1:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001070783.1 Gene:zgc:153911 / 768172 ZFINID:ZDB-GENE-061013-174 Length:288 Species:Danio rerio


Alignment Length:269 Identity:53/269 - (19%)
Similarity:98/269 - (36%) Gaps:91/269 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CLRVTDINVPQ--IVDF-RDNVTLSCSY--DISGHTLNSVKWYKNGKEF---FRYS----PLTPP 75
            |....:|:||:  ::.| .:.:.|.|::  |.|....::|..::.|.:.   |.||    ....|
Zfish    17 CFIEFEISVPRSPVIGFYGEELILPCTFPVDSSWDLSSTVITWQRGLDVVHSFYYSRDQLDRQNP 81

  Fly    76 TYIPFAVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDA-----------------P 123
            .|:......:|.:..||      ..::|:.:..:.:|||.|.:|.::                 |
Zfish    82 HYVSRTSLFIQEMQRGN------ASLKLDKVTQRDAGVYTCSISTNSGSQKKSFAVNIAALYSEP 140

  Fly   124 HFQ----------LTARDA---NMTVEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRIT 175
            ..|          |...|.   :.|::.|.:|:.:      |.:....:..:.||   .|:...:
Zfish   141 RLQFSMLTDGVNLLVTSDGGYPSPTLQWLMENSDI------TNQTQTHLRQDTST---GLYIVSS 196

  Fly   176 WYVNGIKVSLVDLLPSFETTIVAH----GYSMRRIVSQLNFYANEPRFHQLQLQKLIQQKRTISP 236
            |    ||:|.|.   :...|.:.|    |..:||.:             ||...|:.:|:     
Zfish   197 W----IKLSDVS---NSSLTFILHNKPLGQDIRREI-------------QLSSDKIEKQE----- 236

  Fly   237 ARLGLELRC 245
                 |.||
Zfish   237 -----ENRC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 20/90 (22%)
Ig 41..130 CDD:143165 23/124 (19%)
zgc:153911NP_001070783.1 V-set 28..122 CDD:284989 21/99 (21%)
IG_like 35..133 CDD:214653 20/103 (19%)
Ig <156..221 CDD:299845 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.