DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Vb and F11R

DIOPT Version :10

Sequence 1:NP_731748.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens


Alignment Length:195 Identity:37/195 - (18%)
Similarity:71/195 - (36%) Gaps:60/195 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VVRRIQCLRV-------------------TDINVPQIVDFRDNVTLSCSYDISGHTLNSVKW-YK 61
            |.|::.||.:                   .::.:|:    .:.|.|||:|  ||.:...|:| :.
Human     7 VERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPE----NNPVKLSCAY--SGFSSPRVEWKFD 65

  Fly    62 NGKEFFRYSPLTPPTYIPFAVEGVQLIDDGNECNES-SCRVELNLLGV-------KSSGVYRCEV 118
            .|                   :..:|:...|:...| ..||.....|:       :.:|.|.|.|
Human    66 QG-------------------DTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMV 111

  Fly   119 S--GDAPHFQLTARDANMTVEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNGI 181
            |  |...:.::..:    .:..:|.:.|.: :..|:....:...:.||....|..:..||:.:||
Human   112 SEEGGNSYGEVKVK----LIVLVPPSKPTV-NIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGI 171

  Fly   182  181
            Human   172  171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VbNP_731748.1 Ig 24..129 CDD:472250 24/134 (18%)
Ig strand B 41..45 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 2/4 (50%)
Ig strand E 91..103 CDD:409353 4/12 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig strand G 126..129 CDD:409353 0/2 (0%)
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 23/127 (18%)
FR1 30..52 CDD:409538 5/25 (20%)
Ig strand A 30..33 CDD:409538 0/2 (0%)
Ig strand A' 37..41 CDD:409538 0/3 (0%)
Ig strand B 44..53 CDD:409538 5/10 (50%)
CDR1 53..58 CDD:409538 2/4 (50%)
Ig strand C 58..66 CDD:409538 2/7 (29%)
FR2 59..66 CDD:409538 2/6 (33%)
CDR2 69..83 CDD:409538 2/13 (15%)
Ig strand C' 69..74 CDD:409538 1/4 (25%)
Ig strand C' 77..79 CDD:409538 1/1 (100%)
FR3 84..112 CDD:409538 6/27 (22%)
Ig strand D 86..90 CDD:409538 2/3 (67%)
Ig strand E 92..96 CDD:409538 1/3 (33%)
Ig strand F 105..113 CDD:409538 4/7 (57%)
CDR3 113..119 CDD:409538 1/5 (20%)
Ig strand G 119..128 CDD:409538 0/12 (0%)
FR4 120..129 CDD:409538 0/12 (0%)
IgI_2_JAM1 135..231 CDD:409542 9/38 (24%)
Ig strand A 135..139 CDD:409542 1/4 (25%)
Ig strand A' 141..144 CDD:409542 1/2 (50%)
Ig strand B 147..155 CDD:409542 1/7 (14%)
Ig strand C 163..168 CDD:409542 2/4 (50%)
Ig strand C' 170..172 CDD:409542 2/2 (100%)
Ig strand D 187..191 CDD:409542
Ig strand E 195..199 CDD:409542
Ig strand F 208..214 CDD:409542
Ig strand G 221..231 CDD:409542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.