Sequence 1: | NP_001262511.1 | Gene: | beat-Vb / 41583 | FlyBaseID: | FBgn0038092 | Length: | 328 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001008177.1 | Gene: | clmp / 493539 | XenbaseID: | XB-GENE-973667 | Length: | 332 | Species: | Xenopus tropicalis |
Alignment Length: | 202 | Identity: | 44/202 - (21%) |
---|---|---|---|
Similarity: | 76/202 - (37%) | Gaps: | 56/202 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LGRWLLQLGVHMLLVVRRIQCLRVTDINVPQIVDFRDNVTLSCSYDISGH----TLNSVKWYKN- 62
Fly 63 ---GKEFFRYSPLTPPTYIPFAVEGVQLIDDGNECN---------ESSCRVELNLLGVKSSGVYR 115
Fly 116 CEVSGDAPHFQLTARDANMTVEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNG 180
Fly 181 IKVSLVD 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
beat-Vb | NP_001262511.1 | IG_like | 39..121 | CDD:214653 | 21/98 (21%) |
Ig | 41..130 | CDD:143165 | 22/105 (21%) | ||
clmp | NP_001008177.1 | V-set | 29..127 | CDD:369466 | 25/116 (22%) |
Ig_3 | 136..208 | CDD:372822 | 8/40 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 276..332 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |