DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Vb and beat-VI

DIOPT Version :9

Sequence 1:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster


Alignment Length:269 Identity:82/269 - (30%)
Similarity:119/269 - (44%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WL----LQLGVHMLLVVRRIQCLRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKEF 66
            |:    |.|..|         ||:...|.||:.|...:..||||.||:....|.:|:||...:||
  Fly    39 WIIISELLLSAH---------CLKDLKIFVPEAVLMGNAATLSCQYDLEQAALYAVRWYFGQEEF 94

  Fly    67 FRYSPL-TPPTYIPFAVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTAR 130
            :||.|. ..||:: |||.|:.:    :..|..:..|.|..:..:.||.|:||||.|||.|....|
  Fly    95 YRYVPREAKPTFV-FAVAGINV----DLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIR 154

  Fly   131 DANMTVEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNGIKVSLVDLLPSFETT 195
            .|:|.|..||:::|::.........||..:..|:...|.....|||.:||.::....|....:.|
  Fly   155 SAHMQVIELPKDDPVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQIRRTPLQRISQDT 219

  Fly   196 IVAHGYSMRRIVSQLNFYAN--------EPRF-HQLQLQ----------KLIQQK--------RT 233
                 |......|.|:.|.|        |.:: |.:.||          |::.|:        .|
  Fly   220 -----YEGSTTYSSLDIYPNSQALQGFFETKYQHSVNLQCVVTIRHMYHKVVAQRIGLNAAPPTT 279

  Fly   234 ISPARLGLE 242
            |||..||||
  Fly   280 ISPNLLGLE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 31/82 (38%)
Ig 41..130 CDD:143165 35/89 (39%)
beat-VINP_001263035.1 Ig 66..142 CDD:416386 28/80 (35%)
Ig strand B 67..76 CDD:409353 4/8 (50%)
CDR1 76..83 CDD:409353 1/6 (17%)
Ig strand C 83..91 CDD:409353 3/7 (43%)
FR2 84..91 CDD:409353 3/6 (50%)
CDR2 94..108 CDD:409353 6/14 (43%)
Ig strand C' 94..99 CDD:409353 3/4 (75%)
Ig strand C' 102..104 CDD:409353 0/1 (0%)
FR3 109..143 CDD:409353 11/37 (30%)
Ig strand D 117..121 CDD:409353 1/3 (33%)
Ig strand E 123..127 CDD:409353 1/3 (33%)
Ig strand F 136..144 CDD:409353 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.