DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Vb and beat-VII

DIOPT Version :9

Sequence 1:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster


Alignment Length:281 Identity:70/281 - (24%)
Similarity:113/281 - (40%) Gaps:55/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WLLQLGVHMLLVVRRIQCLR-----VTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGK- 64
            |::.|    ||.:::.:.:.     :.::.||:.|:...:.|..|::::....|..|.|.|..| 
  Fly     5 WIIAL----LLGLQQTKPINGQSDVLVNLVVPRYVERGSSATFKCTHNVRPEILFKVTWLKVDKG 65

  Fly    65 EFFRYSPLTPPTYIPFAVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTA 129
            :||.:.....|.:....:||.::  |.:..||.  :|.|..:....||.:.||||.|.|.|...:
  Fly    66 KFFEFINGRNPPFRNSTIEGAEI--DWDNSNEQ--QVTLKDVQFDLSGQFYCEVSTDTPIFTKAS 126

  Fly   130 RDANMTVEALPQNNPLISSF--HSTYRFNDFVEVNCSTDFSSLFTRITWYVNGIKVSLVDLLPSF 192
            .|..|:| .|||..|....|  .:.:...:.:...|:|........|||.:||.||         
  Fly   127 ADELMSV-FLPQTGPPTIKFRKRTPFAVGEKLFALCNTTRGRPAPHITWLINGKKV--------- 181

  Fly   193 ETTIVA--HGYS-------MRRIVSQLNFYANEPRFHQLQLQKLIQQKRTIS--------PA--- 237
            |...|.  |.:|       .||...|     .:.:..|.|||:...|::..:        |.   
  Fly   182 EDRYVRTHHVFSFNGKHQHQRRTQQQ-----QQTQLSQQQLQQQYFQQQYFNQYHQQYHIPVGQF 241

  Fly   238 --RLGLELR--CVAEIDRYPH 254
              |....||  ..|..|.:||
  Fly   242 MDRYDKSLRWPAGARADEFPH 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 23/82 (28%)
Ig 41..130 CDD:143165 26/89 (29%)
beat-VIINP_733162.2 Ig 31..118 CDD:299845 26/90 (29%)
IG_like 34..118 CDD:214653 24/87 (28%)
Ig 141..>183 CDD:299845 10/50 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.