DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Vb and beat-Vc

DIOPT Version :9

Sequence 1:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001356887.1 Gene:beat-Vc / 41575 FlyBaseID:FBgn0038084 Length:297 Species:Drosophila melanogaster


Alignment Length:239 Identity:101/239 - (42%)
Similarity:142/239 - (59%) Gaps:22/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKEFFRYSPLTPPTYIPFAVEGVQLI 88
            |.:::::||:|:|......|.|||.:...|||||||||:|.||||||||||||...|.|:||.:.
  Fly    26 LHLSNLSVPRIIDVAQKAKLFCSYAMGNRTLNSVKWYKDGLEFFRYSPLTPPTTNWFPVKGVTIA 90

  Fly    89 DDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTARDANMTVEALPQNNPLISSFHSTY 153
            |....||:..|.|||..|...|||.||||||||||.|:|..:.|||||..||:.:|.||.....|
  Fly    91 DGSPHCNQFICNVELEKLTAHSSGQYRCEVSGDAPEFKLIDQTANMTVGVLPKFDPFISGVRHAY 155

  Fly   154 RFNDFVEVNCSTDFSSLFTRITWYVNGIKVSLVDLLPSFETTIVAHGYSMRRIVSQLNFYANEPR 218
            :::|::|.||||:.||...::|||:|               ...|.|:|::..:::::  .|...
  Fly   156 KYHDYLEANCSTEMSSPMAKLTWYIN---------------NKTAPGHSLQPQINEVS--RNVDG 203

  Fly   219 FH----QLQLQKLIQQKRTISPARLGLELRCVAEIDRYPHLQRE 258
            ||    .|.|:..:..:|.||.:.: |||||.|:|.....::||
  Fly   204 FHLFASHLHLRLHLDDQRFISKSEM-LELRCTADIMGLAAVRRE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 47/81 (58%)
Ig 41..130 CDD:143165 53/88 (60%)
beat-VcNP_001356887.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444660
Domainoid 1 1.000 192 1.000 Domainoid score I6714
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I6302
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27453
OrthoDB 1 1.010 - - D119006at33392
OrthoFinder 1 1.000 - - FOG0012688
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.